DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13282 and lpl

DIOPT Version :9

Sequence 1:NP_001260521.1 Gene:CG13282 / 35019 FlyBaseID:FBgn0032612 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_571202.1 Gene:lpl / 30354 ZFINID:ZDB-GENE-990415-139 Length:511 Species:Danio rerio


Alignment Length:376 Identity:107/376 - (28%)
Similarity:156/376 - (41%) Gaps:72/376 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SSTEGSTNPTPTSTTTPSNRDITIGPCKWAIGRSCPDPDVKYYIYTRHNPMDRQCLHIDESLEKS 102
            |..|.:.:||..|.|.   .||.....:|.:  ...|.:.|:...|...|.|..|..:..  :..
Zfish    24 SGLETTIDPTAESITL---SDIIGNATEWMM--DFTDIESKFSFRTLEEPEDDLCYIVPG--QPQ 81

  Fly   103 NLTDSYFNPRYPTKIIIHGYN-SDMFLHPLQQMREEYLAK---ADY------NIIYVDWSILSPG 157
            ::.|..||....|.|:|||:. :.||        |.::.|   |.|      |:|.||| :....
Zfish    82 SIKDCNFNTETKTFIVIHGWTVTGMF--------ESWVPKLVTALYEREPSANVIVVDW-LSRAQ 137

  Fly   158 PCYISAVHNTKHAGTCTAQLVERL---VETGNTDIHVIGFSLGAQVPNYIARNLSSFMLPRITGL 219
            ..|.::...||..|...|:.|..|   ::.....:|::|:||||.|.. ||..|:...:.||||:
Zfish   138 QHYPTSASYTKLVGKDVAKFVNWLQAEIDYPWEKLHLLGYSLGAHVAG-IAGLLTKHKVNRITGM 201

  Fly   220 DPAMPLFITSGKADKLDPSDASYVDVIHTNALVQGKMER-------CGHADFYMNGGIMQPGCNG 277
            |||.|.|..:.....|.|.||::|||:|||  .:|..:|       .||.|.|.|||..||||:.
Zfish   202 DPAGPTFEYADSLSTLSPDDANFVDVLHTN--TRGSPDRSIGIQRPVGHIDIYPNGGTFQPGCDL 264

  Fly   278 QKI-------------NSFACSHQRAPAYFLES-IRSPKGFWGWACSGYISYLLGMC-----PPT 323
            |..             ....|||:|:...|::| :........:.||...|:..|||     ...
Zfish   265 QNTMLMVATTGLRNMDQIVKCSHERSIHLFIDSLVNQDHESMAFRCSSRDSFNKGMCLSCRKNRC 329

  Fly   324 NFLLEAGENIRPTTRGMFMIDTNDSSPFAL----------GK----WTDLP 360
            |.:..|...||........:.|.:..|:.:          ||    :||.|
Zfish   330 NKVGYAVNKIRTRRSSKMYMKTREMMPYKVFHYQVKVHFFGKTQLSYTDQP 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13282NP_001260521.1 Lipase 67..351 CDD:278576 92/322 (29%)
Pancreat_lipase_like 75..347 CDD:238363 91/310 (29%)
lplNP_571202.1 lipo_lipase 52..492 CDD:132274 98/343 (29%)
Pancreat_lipase_like 56..353 CDD:238363 91/310 (29%)
PLAT 360..484 CDD:294016 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.