DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13282 and Pnliprp2

DIOPT Version :9

Sequence 1:NP_001260521.1 Gene:CG13282 / 35019 FlyBaseID:FBgn0032612 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_035258.2 Gene:Pnliprp2 / 18947 MGIID:1336202 Length:482 Species:Mus musculus


Alignment Length:325 Identity:106/325 - (32%)
Similarity:148/325 - (45%) Gaps:37/325 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 DPDVKYYIYTRHNPMDRQCLHIDESLEKSNLTDSYFNPRYPTKIIIHGYNSDMFLHPLQQMREEY 138
            |.|.::.:||..||.:.|   |..:.:.:.:..|.|.....|:.||||:........|..|.::.
Mouse    64 DIDTRFLLYTNENPNNYQ---IISATDPATINASNFQLDRKTRFIIHGFIDKGEEGWLLDMCKKM 125

  Fly   139 LAKADYNIIYVDWSILSPGPCYISAVHNTKHAGTCTAQLVERL-VETGNT--DIHVIGFSLGAQV 200
            ......|.|.|||...|... |..|.:||:..|...|.||:.| .|.|.:  ::|:||.|||:.|
Mouse   126 FQVEKVNCICVDWKRGSRTE-YTQASYNTRVVGAEIAFLVQVLSTEMGYSPENVHLIGHSLGSHV 189

  Fly   201 PNYIARNLSSFMLPRITGLDPAMPLFITSGKADKLDPSDASYVDVIHTNA------LVQGKMERC 259
            .....|.|... :.||||||||.|.|....:..:||||||.:||||||::      |..|..::.
Mouse   190 AGEAGRRLEGH-VGRITGLDPAEPCFQGLPEEVRLDPSDAMFVDVIHTDSAPIIPYLGFGMSQKV 253

  Fly   260 GHADFYMNGGIMQPGCNGQKI--------------NSFACSHQRAPAYFLESIRSPKGFWGWACS 310
            ||.||:.|||...|||....:              |..||:|.|:..|:..||.:|.||.|:.||
Mouse   254 GHLDFFPNGGKEMPGCQKNILSTIVDINGIWEGTRNFAACNHLRSYKYYASSILNPDGFLGYPCS 318

  Fly   311 GYISYLLG--------MCPPTNFLLEAGENIRPTTRGMFMIDTNDSSPFALGKWTDLPTL-GAKQ 366
            .|..:...        .||......:..|....|....|.::|.||..|...::....|| |||:
Mouse   319 SYEKFQHNDCFPCPEQGCPKMGHYADQFEGKTATVEQTFFLNTGDSGNFTRWRYKVSVTLSGAKK 383

  Fly   367  366
            Mouse   384  383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13282NP_001260521.1 Lipase 67..351 CDD:278576 100/307 (33%)
Pancreat_lipase_like 75..347 CDD:238363 97/302 (32%)
Pnliprp2NP_035258.2 Lipase 31..367 CDD:278576 100/307 (33%)
Pancreat_lipase_like 65..363 CDD:238363 97/302 (32%)
Required for galactolipase activity. /evidence=ECO:0000250|UniProtKB:P54317 106..118 3/11 (27%)
Required for galactolipase activity. /evidence=ECO:0000250|UniProtKB:P54317 270..292 1/21 (5%)
PLAT_PL 370..482 CDD:238857 5/14 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.