back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG13282 and Lipc

DIOPT Version :10

Sequence 1:	NP_609814.1	Gene:	CG13282 / 35019	FlyBaseID:	FBgn0032612	Length:	484	Species:	Drosophila melanogaster
Sequence 2:	NP_001398717.1	Gene:	Lipc / 15450	MGIID:	96216	Length:	526	Species:	Mus musculus

Alignment Length:	68	Identity:	18/68 - (26%)
Similarity:	25/68 - (36%)	Gaps:	26/68 - (38%)

- Green bases have known domain annotations that are detailed below.

  Fly    69 YVSDDDEDADCSV--------------------LEDDWSEGVL-----EDEVNE-DEYFDADEAP 107
            |::|.|:|....:                    |....|:.|:     ||.||| |.|.|..|:.
Mouse   365 YLTDGDQDVGAIIHNLLANSSYVVQVVALCMNGLTGKMSDQVIVDMPFEDPVNEPDPYGDLAESE 429

  Fly   108 EGN 110
            |.|
Mouse   430 EYN 432

Known Domains:

Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.