DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13282 and Pnliprp2

DIOPT Version :9

Sequence 1:NP_001260521.1 Gene:CG13282 / 35019 FlyBaseID:FBgn0032612 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_476554.1 Gene:Pnliprp2 / 117554 RGDID:620793 Length:482 Species:Rattus norvegicus


Alignment Length:345 Identity:111/345 - (32%)
Similarity:154/345 - (44%) Gaps:49/345 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 RDITIGPCKWAIGRSCPDPDVKYYIYTRHNPMDRQCLHIDESLEKSNLTDSYFNPRYPTKIIIHG 121
            |.:.|.|  |    |..|.|.::.:||..||.:.|.:   .:.|...:..|.|.....|:.|:||
  Rat    53 RPLKIFP--W----SPEDIDTRFLLYTNENPNNYQKI---SATEPDTIKFSNFQLDRKTRFIVHG 108

  Fly   122 Y---NSDMFLHPLQQMREEYLAKADYNIIYVDWSILSPGPCYISAVHNTKHAGTCTAQLVERL-V 182
            :   ..|.:   |..|.::.......|.|.|||...|... |..|.:||:..|...|.||:.| .
  Rat   109 FIDKGEDGW---LLDMCKKMFQVEKVNCICVDWRRGSRTE-YTQASYNTRVVGAEIAFLVQVLST 169

  Fly   183 ETGNT--DIHVIGFSLGAQVPNYIARNLSSFMLPRITGLDPAMPLFITSGKADKLDPSDASYVDV 245
            |.|.:  ::|:||.||||.|.....|.|... :.||||||||.|.|....:..:||||||.:|||
  Rat   170 EMGYSPENVHLIGHSLGAHVVGEAGRRLEGH-VGRITGLDPAEPCFQGLPEEVRLDPSDAMFVDV 233

  Fly   246 IHTNA------LVQGKMERCGHADFYMNGGIMQPGCNGQKI--------------NSFACSHQRA 290
            |||::      |..|..::.||.||:.|||...|||....:              |..||:|.|:
  Rat   234 IHTDSAPIIPYLGFGMSQKVGHLDFFPNGGKEMPGCQKNILSTIVDINGIWEGTQNFVACNHLRS 298

  Fly   291 PAYFLESIRSPKGFWGWACSGYISYLLG--------MCPPTNFLLEAGENIRPTTRGMFMIDTND 347
            ..|:..||.:|.||.|:.||.|..:...        .||......:..|....|......::|.|
  Rat   299 YKYYASSILNPDGFLGYPCSSYEKFQQNDCFPCPEEGCPKMGHYADQFEGKTATVEQTVYLNTGD 363

  Fly   348 SSPFALGKWTDLPTL-GAKQ 366
            |..|...::....|| |||:
  Rat   364 SGNFTRWRYKVSVTLSGAKK 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13282NP_001260521.1 Lipase 67..351 CDD:278576 101/317 (32%)
Pancreat_lipase_like 75..347 CDD:238363 97/305 (32%)
Pnliprp2NP_476554.1 Lipase 31..367 CDD:278576 105/327 (32%)
Pancreat_lipase_like 65..363 CDD:238363 97/305 (32%)
PLAT_PL 370..482 CDD:238857 5/14 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.