DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13282 and LOC100487482

DIOPT Version :9

Sequence 1:NP_001260521.1 Gene:CG13282 / 35019 FlyBaseID:FBgn0032612 Length:484 Species:Drosophila melanogaster
Sequence 2:XP_017945498.2 Gene:LOC100487482 / 100487482 -ID:- Length:347 Species:Xenopus tropicalis


Alignment Length:324 Identity:101/324 - (31%)
Similarity:150/324 - (46%) Gaps:46/324 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 RDITIGPCKWAIGRSCPDP-DVKYYIYTRHNPMDRQCLHIDESLEKSNLTDSYFNPRYPTKIIIH 120
            |.||..|  ||     |:. :|::.:|||.|....|.:   .::..|.::.|.|.....|:.:||
 Frog    40 RPITKLP--WA-----PEKINVQFMLYTRSNQNSYQTV---SAITPSTISSSNFRTSRKTRFVIH 94

  Fly   121 GYNSDMFLHPLQQMREEYLAKADYNIIYVDWSILSPGPCYISAVHNTKHAGTCTAQLVERLVET- 184
            |:.|......:..|.::.|...|.|.|.||||..| ...|..|.:|.:..|...|..|:.|... 
 Frog    95 GFISSGTNSWVTNMCKKLLGIEDVNCIAVDWSGGS-RTLYSQASNNVRVVGAEVAYFVKILQSNF 158

  Fly   185 --GNTDIHVIGFSLGAQVPNYIARNLSSFMLPRITGLDPAMPLFITSGKADKLDPSDASYVDVIH 247
              ...::|:||.||||.......:....  :.||:|||||.|.|..:....:||.|||:.|||||
 Frog   159 AYSPANVHLIGHSLGAHAAGEAGKRQKG--IARISGLDPAEPYFQNTPAEVRLDTSDAALVDVIH 221

  Fly   248 TNA------LVQGKMERCGHADFYMNGGIMQPGC---------------NGQKINSFACSHQRAP 291
            |:|      |..|..:..||.||:.|||:..|||               || .:|...|:|::|.
 Frog   222 TDAGPLVPSLGFGMSQVIGHLDFFPNGGVHMPGCPQNIEIPNVNVEDIWNG-VVNFVTCNHEKAV 285

  Fly   292 AYFLESIRSPKGFWGWACSGYISYLLGMCP--PTNFLLEAGENIRPTTRGMFMIDTNDSSPFAL 353
            :|:.:||.:...|..:.|:.:.:|..|.|.  |:....:.| :...|.||:    |:.|..|.|
 Frog   286 SYYTDSIGNSGTFASYPCANWDTYQRGSCKSCPSAGCPKMG-HYADTYRGV----TSSSQVFYL 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13282NP_001260521.1 Lipase 67..351 CDD:278576 94/310 (30%)
Pancreat_lipase_like 75..347 CDD:238363 91/298 (31%)
LOC100487482XP_017945498.2 Lipase 19..346 CDD:395099 101/324 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.