DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13282 and LOC100331214

DIOPT Version :9

Sequence 1:NP_001260521.1 Gene:CG13282 / 35019 FlyBaseID:FBgn0032612 Length:484 Species:Drosophila melanogaster
Sequence 2:XP_002666287.3 Gene:LOC100331214 / 100331214 -ID:- Length:501 Species:Danio rerio


Alignment Length:313 Identity:89/313 - (28%)
Similarity:142/313 - (45%) Gaps:49/313 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 DVKYYIYTRHNPMDRQCLHIDESLEKSNLTDSYFNPRYPTKIIIHGYN-SDMFLHPLQQM-REEY 138
            :||:.:.....|.|..|..:....|  .|:...||....|.::|||:. |.:|...:::: ...|
Zfish    52 NVKFSLRNPSQPDDDVCYIVRGKAE--TLSSCNFNHTSKTILVIHGWTVSGLFESWVEKLVAALY 114

  Fly   139 LAKADYNIIYVDWSILSPGPCYISAVHNTKHAGTCTAQLVERLVETGNT---DIHVIGFSLGAQV 200
            ..:.|.|:|.||| :.:....|:.|..|||..|......::.:.||.|.   ::|:||:||||.|
Zfish   115 NREKDANVIVVDW-LDTAQDHYVVAAQNTKMVGREIGLFIDWIEETSNVPLENLHLIGYSLGAHV 178

  Fly   201 PNYIARNLSSFMLPRITGLDPAMPLFITSGKADKLDPSDASYVDVIHTNALVQGKM-------ER 258
            ..:...:.:: .:.||||||||.|.|.......:|.|.||.:|||:||  ..:|.:       :.
Zfish   179 AGFAGSHTTN-KIGRITGLDPAGPDFEGVHAHGRLSPDDAHFVDVLHT--FTRGSLGLSIGIEQP 240

  Fly   259 CGHADFYMNGGIMQPGCN--G--QKI---------NSFACSHQRAPAYFLESIRSPKGFW-GWAC 309
            .||.|.|.|||..|||||  |  :|:         |:..|.|:|:...|::|:.:.:... .::|
Zfish   241 VGHVDIYPNGGSFQPGCNLRGALEKMASYGIFAINNAIRCEHERSIHLFIDSLLNEEAAGRAYSC 305

  Fly   310 SGYISYLLGMCPPTNFLLEAGEN-----------IRPTTRGMFMIDTNDSSPF 351
            .....:..|:|      |:..:|           :|..........|..|.||
Zfish   306 GSNDMFDRGVC------LQCRKNGCNTVGYDISKVRKARSVKMFTKTRGSMPF 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13282NP_001260521.1 Lipase 67..351 CDD:278576 87/311 (28%)
Pancreat_lipase_like 75..347 CDD:238363 86/307 (28%)
LOC100331214XP_002666287.3 lipo_lipase 47..487 CDD:132274 89/313 (28%)
Pancreat_lipase_like 51..347 CDD:238363 85/306 (28%)
PLAT_LPL 355..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.