DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13280 and GFOD2

DIOPT Version :9

Sequence 1:NP_609812.1 Gene:CG13280 / 35015 FlyBaseID:FBgn0032609 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_110446.3 Gene:GFOD2 / 81577 HGNCID:28159 Length:385 Species:Homo sapiens


Alignment Length:357 Identity:74/357 - (20%)
Similarity:133/357 - (37%) Gaps:68/357 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 QSHALAFAERHQVENVYTS-FEDLAKCPNVDVVYISPLNPQHSELCHLMLNHDKHVLCEKPLCMT 191
            :..|...||...:. .||| .:|:....:||:|.||...|...::....|...|:|:|||  ..|
Human    38 EEEAKQLAEEMNIA-FYTSRTDDILLHQDVDLVCISIPPPLTRQISVKALGIGKNVVCEK--AAT 99

  Fly   192 EEQVTKLLEKAR-ARGLFLMEGMWPRCVPAYHYLRHQILRNRLGEI----KQVHCTLGLPVSQGR 251
            .....:::..:| ...|..:.|...|.:||:..::..|..:.:|.:    .:::....|..|.|.
Human   100 SVDAFRMVTASRYYPQLMSLVGNVLRFLPAFVRMKQLISEHYVGAVMICDARIYSGSLLSPSYGW 164

  Fly   252 LG---LYGGVTNDFGVYGMQLALWV----FREVPRCLKVSGRVNS-----EHV------------ 292
            :.   :.||..:..|.|.:.|...:    ..:|...||...|.|:     .||            
Human   165 ICDELMGGGGLHTMGTYIVDLLTHLTGRRAEKVHGLLKTFVRQNAAIRGIRHVTSDDFCFFQMLM 229

  Fly   293 --DVSADIELCFTRGKRALIEV----SSEKKLSNQAVIQGKDGSIKMNNYWCPTRLITEEVDYEF 351
              .|.:.:.|.|......:.||    |:.:.::..|.:.|:..|......     |:.:.:....
Human   230 GGGVCSTVTLNFNMPGAFVHEVMVVGSAGRLVARGADLYGQKNSATQEEL-----LLRDSLAVGA 289

  Fly   352 PLP-GGDQLPPTHYHNRLGMCYEAEEVRNCIL-KGSTESDD-------FSHNESLLLANLMDTIH 407
            .|| .|.|..|..|..  ||.|..:.:|.... :|...:.|       .|..:.|.:.:::|.|.
Human   290 GLPEQGPQDVPLLYLK--GMVYMVQALRQSFQGQGDRRTWDRTPVSMAASFEDGLYMQSVVDAIK 352

  Fly   408 AELGVGEFANRNEVSDLQKQIENVQDIVKDPE 439
            .....||:             |.|:.:.::|:
Human   353 RSSRSGEW-------------EAVEVLTEEPD 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13280NP_609812.1 MviM 89..387 CDD:223745 64/296 (22%)
GFO_IDH_MocA 92..213 CDD:279716 22/86 (26%)
GFOD2NP_110446.3 MviM 1..364 CDD:223745 72/348 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0673
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.