DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13280 and Dhdh

DIOPT Version :9

Sequence 1:NP_609812.1 Gene:CG13280 / 35015 FlyBaseID:FBgn0032609 Length:473 Species:Drosophila melanogaster
Sequence 2:XP_006541262.1 Gene:Dhdh / 71755 MGIID:1919005 Length:376 Species:Mus musculus


Alignment Length:374 Identity:111/374 - (29%)
Similarity:166/374 - (44%) Gaps:60/374 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 LRWGIAPVSLMADDFAAALSVLPEQHHRIVSCVAAYQSHALAFAERHQVENVYTSFEDLAKCPNV 156
            |||||....|:|:||...||.||...|::|:..|...:.|..||::..:...|.|:|:|||.|||
Mouse     3 LRWGIVSAGLIANDFTTVLSSLPSSEHQVVAVAARDLNRAEEFAQKFNIPKAYGSYEELAKDPNV 67

  Fly   157 DVVYISPLNPQHSELCHLMLNHDKHVLCEKPLCMTEEQVTKLLEKARARGLFLME---------- 211
            :|.||:..:|||.....|.|...|.||||||:.:...:|.:::.|||::|:||||          
Mouse    68 EVAYIATQHPQHKPAVLLCLAAGKAVLCEKPMGVNAAEVREMVAKARSQGVFLMEMAGPLEACVS 132

  Fly   212 ---------------------------------GMWPRCVPAYHYLRHQILRNRLGEIKQVHCTL 243
                                             .:|.|..||...||..:::..:|:::......
Mouse   133 CFSRSQMPSFFTRSCCELVRHLHLSLLLEVPVMAIWSRFFPAMEALREVLVQGTIGDLRVARAEF 197

  Fly   244 GLPVSQ-------GRLGLYGGVTNDFGVYGMQLALWVF-REVPRCLKVSGRVNSEHVDVSADIEL 300
            |..:|.       .:.|  ||:. |.|:|.:|....:| .:.|..:...||::...||.:..:.|
Mouse   198 GFDLSHIPRATDWNQAG--GGLL-DLGIYCVQFLSMIFGAQKPEKISAVGRIHETGVDDTVSVLL 259

  Fly   301 CFTRGKRALIEVSSEKKLSNQAVIQGKDGSIKMNNYWCPTRLITEEVDYEFPLP--GGDQLPPTH 363
            .:..|.......|....|.|.|.:.|..|..::...|.||.|:......|||.|  |.|.    :
Mouse   260 QYPGGVHGSFTCSISSNLPNTAYVSGTKGMAQIQKLWAPTELVVNGERKEFPPPVLGKDY----N 320

  Fly   364 YHNRLGMCYEAEEVRNCILKGSTESDDFSHNESLLLANLMDTIHAELGV 412
            :.|...|.|||..||.|:.||..||......||.|||.:::.....:||
Mouse   321 FVNGSCMLYEANHVRECLRKGLKESPVVPLAESELLAEILEEARKAIGV 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13280NP_609812.1 MviM 89..387 CDD:223745 102/347 (29%)
GFO_IDH_MocA 92..213 CDD:279716 52/163 (32%)
DhdhXP_006541262.1 MviM 1..368 CDD:223745 109/371 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850699
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0673
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4313
OMA 1 1.010 - - QHG57478
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001373
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22604
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X868
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.760

Return to query results.
Submit another query.