DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13280 and Gfod2

DIOPT Version :9

Sequence 1:NP_609812.1 Gene:CG13280 / 35015 FlyBaseID:FBgn0032609 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001355314.1 Gene:Gfod2 / 70575 MGIID:1917825 Length:425 Species:Mus musculus


Alignment Length:405 Identity:80/405 - (19%)
Similarity:142/405 - (35%) Gaps:110/405 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 QSHALAFAERHQVENVYTS-FEDLAKCPNVDVVYIS---PLNPQHS-----ELCHLMLNHD---- 179
            :..|...||...: ..||| .:|:....:||:|.|:   ||..|.|     .:..|.|:.:    
Mouse    38 EEEAKQLAEEMNI-TFYTSRTDDVLLHQDVDLVCINIPPPLTRQISVKALAPVVKLQLSGEEQEV 101

  Fly   180 ----------------------------KHVLCEKPLCMTEEQVTKLLEKAR-ARGLFLMEGMWP 215
                                        |:|:|||  ..|.....:::..:| ...|..:.|...
Mouse   102 EGDPGLTSLDAVTPYSTGAPCCSRKGIGKNVVCEK--AATSMDAFRMVTASRYYPQLMSLVGNVL 164

  Fly   216 RCVPAYHYLRHQILRNRLGEI----KQVHCTLGLPVSQGRLG---LYGGVTNDFGVYGMQLALWV 273
            |.:||:..::..|..:.:|.:    .:::....|..|.|.:.   :.||..:..|.|.:.|...:
Mouse   165 RFLPAFVRMKQLIAEHYVGAVMICDARIYSGSLLSPSYGWICDELMGGGGLHTMGTYIVDLLTHL 229

  Fly   274 ----FREVPRCLKVSGRVNS-----EHV--------------DVSADIELCFTRGKRALIEV--- 312
                ..:|...||...|.|:     .||              .|.:.:.|.|......:.||   
Mouse   230 TGQKAEKVHGLLKTFVRQNATIRGIRHVTSDDFCFFQMLMGGGVCSTVTLNFNMPGAFVHEVMVV 294

  Fly   313 -SSEKKLSNQAVIQGKDGSIKMNNYWCPTRLITEEVDYEFPLP-GGDQLPPTHYHNRLGMCYEAE 375
             |:.:.::..|.:.|:..|......     |:.:.:.....|| .|.|..|..|..  ||.|..:
Mouse   295 GSAGRLVARGADLYGQKNSAAQEEL-----LVRDSLAVGAGLPEQGPQDVPLLYLK--GMVYMVQ 352

  Fly   376 EVRNCIL-KGSTESDD-------FSHNESLLLANLMDTIHAELGVGEFANRNEVSDLQKQIENVQ 432
            .:|.... :|...:.|       .|..:.|.:.:::|.|......||:             |.|:
Mouse   353 ALRQSFQGQGDRRTWDRTPVSMAASFEDGLYMQSVVDAIKRSSRSGEW-------------ETVE 404

  Fly   433 DIVKDPE--ELASET 445
            .:.::|:  :..|||
Mouse   405 MLAEEPDANQNLSET 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13280NP_609812.1 MviM 89..387 CDD:223745 67/336 (20%)
GFO_IDH_MocA 92..213 CDD:279716 25/126 (20%)
Gfod2NP_001355314.1 MviM 7..404 CDD:223745 75/388 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0673
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.