DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13280 and BLVRA

DIOPT Version :9

Sequence 1:NP_609812.1 Gene:CG13280 / 35015 FlyBaseID:FBgn0032609 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_000703.2 Gene:BLVRA / 644 HGNCID:1062 Length:296 Species:Homo sapiens


Alignment Length:211 Identity:48/211 - (22%)
Similarity:83/211 - (39%) Gaps:28/211 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 LAFAERHQVENV----YTSFEDLAKCPNVDVVYISPLNPQHSELCHLMLNHDKHVLCEKPLCMTE 192
            :.|..|.::.::    ..|.||......|:|.||...:..|.:.....||..||||.|.|:.::.
Human    40 IGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSL 104

  Fly   193 EQVTKLLEKARARGLFLMEGMWPRCVPAYHYLRHQILRNRLGEIK-QVHCTLGLPVSQGRLGLYG 256
            ....:|.|.|..:|..|.|......:..:.:|:.:::...|  :| .:..|.| |:.:.|.|   
Human   105 AAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDL--LKGSLLFTAG-PLEEERFG--- 163

  Fly   257 GVTNDFGVY-GMQLALWVFREVPRCLKVSGRVNSEHVDVSADIELCFTRGKRALIEVSSEKKLSN 320
                 |..: |:....|:.........||..:.....|....:.:|          :.:||| |.
Human   164 -----FPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVC----------LETEKK-SP 212

  Fly   321 QAVIQGKDGSIKMNNY 336
            .:.|:.|...:|.|.|
Human   213 LSWIEEKGPGLKRNRY 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13280NP_609812.1 MviM 89..387 CDD:223745 48/211 (23%)
GFO_IDH_MocA 92..213 CDD:279716 24/84 (29%)
BLVRANP_000703.2 GFO_IDH_MocA 18..125 CDD:279716 24/84 (29%)
Biliv-reduc_cat 133..242 CDD:312620 24/118 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0673
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.