DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13280 and gfod2

DIOPT Version :9

Sequence 1:NP_609812.1 Gene:CG13280 / 35015 FlyBaseID:FBgn0032609 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001025591.1 Gene:gfod2 / 594979 XenbaseID:XB-GENE-5740207 Length:384 Species:Xenopus tropicalis


Alignment Length:420 Identity:89/420 - (21%)
Similarity:138/420 - (32%) Gaps:136/420 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 GVWVVDEGPTLRWGIAPVSLM-ADDFAAALSVLPEQHHRIVSCVAAYQSHALAFAERHQVENVYT 145
            |:.|...|.|.|   ..:||: ||.|:            |.:........|...||...:.....
 Frog     6 GIGVFGTGNTAR---VLISLLRADGFS------------IEALWGKTDEEAKELAEEMGIPFYTC 55

  Fly   146 SFEDLAKCPNVDVVYISPLNPQHSELCHLMLNHDKHVLCEKPL----CMTEEQVTKLLEKARARG 206
            ..:|:.....||:|.||...|...::....|...|:|:|||..    ..|..:..:...|     
 Frog    56 HTDDVLLHQEVDLVCISIPPPLTRQIAVKALGIGKNVICEKAASSIDAFTMVKAARYYPK----- 115

  Fly   207 LFLMEGMWPRCVPAYHYLRHQIL-RNRLGEIK--QVHCTLGLPVSQG-------RLGLYGGVTND 261
            |..:.|...|.:||:..:|..|| :|.:|||:  .|....|..:|..       .:|  ||..:.
 Frog   116 LMSLVGNALRFLPAFDRMRQLILEQNYVGEIRICDVRVYGGSLLSSNYSWICDDLMG--GGGLHT 178

  Fly   262 FGVYGMQLALWVFREVPRCLKVSGRV-----NSEHVD----VSADIELCFTRGKRALIEVSSEKK 317
            .|.|.:.|...:..:  |..||.|.:     .:|.:.    |::| :.||.:             
 Frog   179 LGTYLVDLLTHLTNK--RAEKVHGFLKTFVKQNEAISGIRYVTSD-DFCFFQ------------- 227

  Fly   318 LSNQAVIQGKDGSIKMNNYWCPTRLITEEVDYEFPLPGGDQLPPTHYH--------NRLGMCYEA 374
                         ::|....|.|      |...|.:||      |..|        .||      
 Frog   228 -------------MQMTGGACST------VTLNFNMPG------TFVHEVMVVGSAGRL------ 261

  Fly   375 EEVRNCILKGSTESDDFSHNESLLLANLMDTIHAELGVGEFANRNEVSDLQKQIENVQDIVKDPE 439
             .||...|.|...|   :..|.|||::                     .|.::|.::.|..|.|.
 Frog   262 -VVRGTELFGQKNS---ASEEKLLLSD---------------------PLTREIADISDFEKVPP 301

  Fly   440 ELASETCRVVEDISMGGRSLDINRQEVKDQ 469
            ........:|:.:          ||..:||
 Frog   302 PYLMGIAHMVKAL----------RQSFQDQ 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13280NP_609812.1 MviM 89..387 CDD:223745 72/329 (22%)
GFO_IDH_MocA 92..213 CDD:279716 26/125 (21%)
gfod2NP_001025591.1 MviM 1..365 CDD:223745 89/420 (21%)
GFO_IDH_MocA 7..118 CDD:279716 29/130 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 358..384
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.