DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13280 and gfod1

DIOPT Version :9

Sequence 1:NP_609812.1 Gene:CG13280 / 35015 FlyBaseID:FBgn0032609 Length:473 Species:Drosophila melanogaster
Sequence 2:XP_012819881.1 Gene:gfod1 / 394777 XenbaseID:XB-GENE-947602 Length:404 Species:Xenopus tropicalis


Alignment Length:429 Identity:78/429 - (18%)
Similarity:144/429 - (33%) Gaps:163/429 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 DEGPTLR--WGIAPVSLMADDFAAALSVLPEQHHRIVSCVAAYQSHALAFAERHQVENVYTSFED 149
            |||.:::  ||.....  |::.|..:|| |...:||                           :|
 Frog    23 DEGFSVKALWGRTQEE--AEELAKEMSV-PFYTNRI---------------------------DD 57

  Fly   150 LAKCPNVDVVYISPLNPQHSELCHLMLNHD--------------KHVLCEKPLCMTEEQVTKLLE 200
            :....:||:|.|:...|...::....|...              |:|:|::  ..|.....:::.
 Frog    58 VLLHQDVDLVCINLPPPLTKQIAVKTLEGQETEDRNENGSTGIGKNVICDR--TATPLDAFRMMS 120

  Fly   201 KAR-ARGLFLMEGMWPRCVPAYHYLRHQILRNRLGEIK----QVHCTLGLPVSQGRLG------- 253
            .|. ...|..:.|...|.:||:..::..|....:||::    |||       |...||       
 Frog   121 AAHYYPKLMSIMGNVLRFLPAFVKMKQLIQEGYVGELQVCEVQVH-------SGSLLGKKYNWSC 178

  Fly   254 ---LYGGVTNDFGVYGMQLALWVFREVPRCLKVSGRV-----NSEHVDVSADIELCFTRGKRALI 310
               :.||..:..|.|.:.|.  .|....:.:||.|.:     .::|:              :.:.
 Frog   179 DDLMGGGGLHSVGSYIIDLL--TFLTSQKAVKVHGLLKTFVKQTDHI--------------KGIR 227

  Fly   311 EVSSEKKLSNQAVIQGKDGSIKMNNYWCPTRLITEEVDYEFPLPGGDQLPPTHYHNRLGMCYEAE 375
            :::|:...:.|.|::|.         .|.|      |...|.:||                   |
 Frog   228 QITSDDFCTFQMVLEGG---------VCCT------VTLNFNVPG-------------------E 258

  Fly   376 EVRNCILKGSTESDDFSHNESLLLANLMDTIHAELGVGEFANRNEVSDLQKQIENVQDIVKD--P 438
            ..::.|:.||.             ..|:.|     |:..:..||..||.:..:::...:...  |
 Frog   259 FKQDVIVVGSA-------------GRLIVT-----GIDLYGQRNSSSDRELLLKDSTPVSNSLLP 305

  Fly   439 EELASE--------TCRVVEDISMGGRSLDINRQEVKDQ 469
            |:..|:        |.::|:.:          ||..:||
 Frog   306 EKAFSDIPSPYLRGTIKMVQAV----------RQAFQDQ 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13280NP_609812.1 MviM 89..387 CDD:223745 60/333 (18%)
GFO_IDH_MocA 92..213 CDD:279716 22/137 (16%)
gfod1XP_012819881.1 MviM 5..376 CDD:223745 78/429 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.