DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13280 and Gfod1

DIOPT Version :9

Sequence 1:NP_609812.1 Gene:CG13280 / 35015 FlyBaseID:FBgn0032609 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001163805.1 Gene:Gfod1 / 306842 RGDID:1311507 Length:390 Species:Rattus norvegicus


Alignment Length:253 Identity:51/253 - (20%)
Similarity:99/253 - (39%) Gaps:50/253 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 GIAPVSLMADDFAAALSVLPEQHHRIVSCVAAYQSHALAFAERHQVENVYTS-FEDLAKCPNVDV 158
            |:...||.|   ...:.:|.::...:.:.....|..|...|:...|. .||| .:::....:||:
  Rat     6 GVFGTSLTA---RVIIPLLKDEGFAVKALWGRTQEEAEELAKEMSVP-FYTSRIDEVLLHQDVDL 66

  Fly   159 VYISPLNPQHSELCHLMLNHDKHVLCEKPLCMTEEQVTKLLEKAR-ARGLFLMEGMWPRCVPAYH 222
            |.|:...|...::....|...|:|:|::  ..|.....:::..|. ...|..:.|...|.:||:.
  Rat    67 VCINLPPPLTRQIAVKTLGIGKNVICDR--TATPLDAFRMMSAAHYYPKLMSIMGNVLRFLPAFV 129

  Fly   223 YLRHQILRNRLGEI----KQVHCTLGLPVSQGRLG----------LYGGVTNDFGVYGMQLALWV 273
            .::..|....:||:    .|||       |...||          :.||..:..|.|.:.|.  .
  Rat   130 RMKQLIEEGYVGELLVCEVQVH-------SGSLLGKKYNWSCDDLMGGGGLHSVGTYIIDLL--T 185

  Fly   274 FREVPRCLKVSGRV-----NSEHVDVSADIELCFTRGKRALIEVSSEKKLSNQAVIQG 326
            |....:.:||.|.:     .::|:              :.:.:::|:...:.|.|::|
  Rat   186 FLTGQKAVKVHGLLKTFVKQTDHI--------------KGIRQITSDDFCTFQMVLEG 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13280NP_609812.1 MviM 89..387 CDD:223745 51/253 (20%)
GFO_IDH_MocA 92..213 CDD:279716 24/119 (20%)
Gfod1NP_001163805.1 MviM 5..363 CDD:223745 51/253 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0673
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.