DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17928 and AgaP_AGAP010149

DIOPT Version :9

Sequence 1:NP_001260515.1 Gene:CG17928 / 35009 FlyBaseID:FBgn0032603 Length:441 Species:Drosophila melanogaster
Sequence 2:XP_001238141.1 Gene:AgaP_AGAP010149 / 4578199 VectorBaseID:AGAP010149 Length:74 Species:Anopheles gambiae


Alignment Length:49 Identity:28/49 - (57%)
Similarity:33/49 - (67%) Gaps:0/49 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ISRNYPSYRQHRPITSESWLEGKNVDDEAEGLWRINDTLYDLSDFAARH 64
            |:..||::|.....|..:||:||..||.|||||||||.||||.|||..|
Mosquito    26 ITHRYPTFRDEPFKTVHNWLDGKRYDDGAEGLWRINDDLYDLEDFAHTH 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17928NP_001260515.1 Cyt-b5 33..103 CDD:278597 23/32 (72%)
Membrane-FADS-like 151..388 CDD:294412
FA_desaturase 171..412 CDD:278890
AgaP_AGAP010149XP_001238141.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 260 1.000 Domainoid score I4578
eggNOG 1 0.900 - - E1_COG3239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 447 1.000 Inparanoid score I3490
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1060606at2759
OrthoFinder 1 1.000 - - FOG0012745
OrthoInspector 1 1.000 - - mtm9664
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11811
TreeFam 1 0.960 - -
98.830

Return to query results.
Submit another query.