DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17928 and fat-1

DIOPT Version :9

Sequence 1:NP_001260515.1 Gene:CG17928 / 35009 FlyBaseID:FBgn0032603 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001023560.1 Gene:fat-1 / 178291 WormBaseID:WBGene00001393 Length:402 Species:Caenorhabditis elegans


Alignment Length:174 Identity:43/174 - (24%)
Similarity:64/174 - (36%) Gaps:59/174 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 QFLIRLVLSLTKRNVLCWDDLIGFSLPIFIYLSTGVSLLSALLSWEIIISVGSFIFGLVGLTAAH 331
            ::|::...:||         ::.|:||.|.|..     |...|.|.|.:.|..|...:||     
 Worm    77 RYLVQDFAALT---------ILYFALPAFEYFG-----LFGYLVWNIFMGVFGFALFVVG----- 122

  Fly   332 HDPRILHDGDAQRQDFDWGLYQVDTIIDRGDIKWSDLLVLTHF---GEHALHHLFPT---LDHGV 390
            ||  .||...:..|:.:      |.|   |.|.:|.|. ..:|   ..|.|||.|..   .||| 
 Worm   123 HD--CLHGSFSDNQNLN------DFI---GHIAFSPLF-SPYFPWQKSHKLHHAFTNHIDKDHG- 174

  Fly   391 LKHLYPELRKTMKEFDVELREINHWSHIKGQNQQLLRTEKNPIP 434
              |::.:        |.:...:..|           :...||||
 Worm   175 --HVWIQ--------DKDWEAMPSW-----------KRWFNPIP 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17928NP_001260515.1 Cyt-b5 33..103 CDD:278597
Membrane-FADS-like 151..388 CDD:294412 33/126 (26%)
FA_desaturase 171..412 CDD:278890 38/150 (25%)
fat-1NP_001023560.1 DesA 52..387 CDD:225779 43/174 (25%)
Delta12-FADS-like 70..338 CDD:239584 43/174 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.