DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17928 and LOC101732828

DIOPT Version :9

Sequence 1:NP_001260515.1 Gene:CG17928 / 35009 FlyBaseID:FBgn0032603 Length:441 Species:Drosophila melanogaster
Sequence 2:XP_031756398.1 Gene:LOC101732828 / 101732828 -ID:- Length:122 Species:Xenopus tropicalis


Alignment Length:105 Identity:23/105 - (21%)
Similarity:41/105 - (39%) Gaps:23/105 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 WIPDSHYASKPQRLISVVISPVVYVVLFQGQFLIRLVLSLTKRNVLCWDDL-------IGFSLPI 294
            ::|.:|     |......|.|...:.::...::....:...|     |.||       :.|.|..
 Frog     6 YMPYNH-----QHKYFFFIGPPALIPVYSQWYIFYFAIRRKK-----WADLAWMISFYVRFGLCY 60

  Fly   295 FIYLSTGVSLLSALLSWEIIISVGSFIFGLVGLTAAHHDP 334
            ..:|  |||...||  :.::..:.|.:|  |.:|..:|.|
 Frog    61 IPFL--GVSGTIAL--FMVVRFIESNLF--VWVTQMNHIP 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17928NP_001260515.1 Cyt-b5 33..103 CDD:278597
Membrane-FADS-like 151..388 CDD:294412 23/105 (22%)
FA_desaturase 171..412 CDD:278890 23/105 (22%)
LOC101732828XP_031756398.1 Membrane-FADS-like <36..>104 CDD:294412 18/70 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1060606at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.