DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17928 and LOC101732591

DIOPT Version :9

Sequence 1:NP_001260515.1 Gene:CG17928 / 35009 FlyBaseID:FBgn0032603 Length:441 Species:Drosophila melanogaster
Sequence 2:XP_031756608.1 Gene:LOC101732591 / 101732591 -ID:- Length:206 Species:Xenopus tropicalis


Alignment Length:173 Identity:38/173 - (21%)
Similarity:62/173 - (35%) Gaps:59/173 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 RGTDITEPFESH--HIEERARGMLS-------KFEVRKAA---RPRNYKFTLEENGFYMTLKRRV 127
            :|| |.:|:.|.  |::    |.|:       ...:..||   .||::....|:.|.::...|.:
 Frog     3 KGT-IKKPYPSDVGHLD----GYLTSAMEFGWSLTMNTAAVPPSPRSFSLLSEQRGSHIKEGRGL 62

  Fly   128 REKLRKIDYSPTKKTE--FLHLG--ILVSV------FLFS-----WAGTV----------LDSLI 167
            :..::|..|.|.....  |..:|  .|:.|      |.|:     ||...          |..:.
 Frog    63 QLGMKKKKYMPYNHQHKYFFFIGPPALIPVYSQWYIFYFAIRRKKWADLAWMISFYVRFGLCYIP 127

  Fly   168 FKGLAG-LAL------------CWVATSTH---NY-FHQRDSW 193
            |.|::| :||            .||....|   |. :.|...|
 Frog   128 FLGVSGTIALFMVVRFIESDWFVWVTQMNHIPMNIDYDQNKEW 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17928NP_001260515.1 Cyt-b5 33..103 CDD:278597 8/36 (22%)
Membrane-FADS-like 151..388 CDD:294412 17/81 (21%)
FA_desaturase 171..412 CDD:278890 9/40 (23%)
LOC101732591XP_031756608.1 Membrane-FADS-like <63..>175 CDD:294412 23/108 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1060606at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.