DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-b5-r and Fads1

DIOPT Version :9

Sequence 1:NP_001260514.1 Gene:Cyt-b5-r / 35008 FlyBaseID:FBgn0000406 Length:436 Species:Drosophila melanogaster
Sequence 2:XP_006231137.1 Gene:Fads1 / 84575 RGDID:621678 Length:471 Species:Rattus norvegicus


Alignment Length:476 Identity:94/476 - (19%)
Similarity:170/476 - (35%) Gaps:160/476 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SWQKGKRQDDGAEGLWRIND-GIYDFTSFIDKHPGGPFWIRETKGTDITEAFEAHHLTTAPEKMI 91
            :|::..::....:..|.:.| .:|:.:.|..:||||...|....|.|.|:.|.|.|:.   :.::
  Rat    23 TWEEVAQRSGREKERWLVIDRKVYNISDFSRRHPGGSRVISHYAGQDATDPFVAFHIN---KGLV 84

  Fly    92 AKYKVRDAAEPRIYTLTLEEGGF----------------------------YKTLKERVREQLKT 128
            .||    .....|..|..|:..|                            .|.|.:..||...|
  Rat    85 RKY----MNSLLIGELAPEQPSFEPTKNLPPWEVLFKGWGATEKNSSPCLPQKALTDEFRELRAT 145

  Fly   129 IDKRPKKKSD-------LIHLGLV-----VSLYLLGIASAKYNSLLALVLASV--ALCWTVIVSH 179
            :::....|::       |:|:.|:     ::|::.|.:...: :|.|::|::|  ...|   :.|
  Rat   146 VERMGLMKANHLFFLFYLLHILLLDVAAWLTLWIFGTSLVPF-TLCAVLLSTVQAQAGW---LQH 206

  Fly   180 NYFH----RRDNWQ--MYAFNLGMMNFAA---WRVSHALSHHIYPNSY-FDLELSMFEPL----- 229
            ::.|    ....|.  ::.|.:|.:..|.   |...| ..||..||.: .|.:::| .||     
  Rat   207 DFGHLSVFSTSTWNHLVHHFVIGHLKGAPASWWNHMH-FQHHAKPNCFRKDPDINM-HPLFFALG 269

  Fly   230 -LCWVPNPHIKSKLMRY-------------------------------VSWVTEPVAYALAFFIQ 262
             :..|.....|.|.|.|                               ..||  .:|:.|:|:: 
  Rat   270 KVLSVELGKEKKKHMPYNHQHKYFFLIGPPALLPLYFQWYIFYFVVQRKKWV--DLAWMLSFYV- 331

  Fly   263 MGTRIFYSLRHTNILYWHDLLPLTIPIAIYLGTGGSLGIWICVR----QWLAMTSIASFSFCLIG 323
               |:|::           .:||       ||..|.|.::..||    .|            .:.
  Rat   332 ---RVFFT-----------YMPL-------LGLKGLLCLFFIVRFLESNW------------FVW 363

  Fly   324 LNAAHHDP-EIYHEGDANREDRDWGLFQVDTIIDRGDLKWSQFLVLTHFGDHVLHHLFPTLD--- 384
            :...:|.| .|.|:.:.     ||...|:....:.....::.:. ..|....:.||||||:.   
  Rat   364 VTQMNHIPMHIDHDRNV-----DWVSTQLQATCNVHQSAFNNWF-SGHLNFQIEHHLFPTMPRHN 422

  Fly   385 -HGLLP------ALYPVLYQT 398
             |.:.|      |.|.:.|::
  Rat   423 YHKVAPLVQSLCAKYGIKYES 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-b5-rNP_001260514.1 Cyt-b5 26..98 CDD:278597 18/70 (26%)
FA_desaturase 161..408 CDD:278890 61/302 (20%)
Membrane-FADS-like <328..385 CDD:294412 14/61 (23%)
Fads1XP_006231137.1 PLN03199 12..466 CDD:178740 94/476 (20%)
Cyt-b5 21..96 CDD:278597 19/79 (24%)
Delta6-FADS-like 189..439 CDD:239583 60/296 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I5335
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1060606at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.