DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-b5-r and SLD1

DIOPT Version :9

Sequence 1:NP_001260514.1 Gene:Cyt-b5-r / 35008 FlyBaseID:FBgn0000406 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_191717.1 Gene:SLD1 / 825331 AraportID:AT3G61580 Length:449 Species:Arabidopsis thaliana


Alignment Length:485 Identity:102/485 - (21%)
Similarity:164/485 - (33%) Gaps:166/485 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ITTHSWQKGKRQDDGAEGLW-RINDGIYDFTSFIDKHPGGPFWIRETKGTDITEAFEAHHLTTA- 86
            ||....:|..:..|    || .|...:|:.:.:|..||||...|....|.|:|:||.|.|..|| 
plant    10 ITNEDLKKHNKSGD----LWIAIQGKVYNVSDWIKTHPGGDTVILNLVGQDVTDAFIAFHPGTAW 70

  Fly    87 --PEKMIAKYKVRDAAEPRIYTLTLEEGGFYKTLKERVREQLKTIDKRPKKKSDLIHLGLV---- 145
              .:.:...|.:||..       ..|....|:.:....|:                 |||.    
plant    71 HHLDHLFTGYHIRDFQ-------VSEVSRDYRRMAAEFRK-----------------LGLFENKG 111

  Fly   146 -VSLYLLGIASAKYNSLLALVLAS------------VALCWT------------VIVSHNYFHRR 185
             |:||.|...:|.:..:|..|||.            :.|.|.            ||:|:..::|.
plant   112 HVTLYTLAFVAAMFLGVLYGVLACTSVFAHQIAAALLGLLWIQSAYIGHDSGHYVIMSNKSYNRF 176

  Fly   186 DNWQMYAFN-LGMMNFAAWRVSHALSHHIYPNS--------------------------YFDLEL 223
            .  |:.:.| |..::.|.|:.:|. :||:..||                          ::|.:|
plant   177 A--QLLSGNCLTGISIAWWKWTHN-AHHLACNSLDYDPDLQHIPVFAVSTKFFSSLTSRFYDRKL 238

  Fly   224 SMFEPLLCWVPNPHIKSKLMRYVSWVTEPVAY--ALAFFIQMGTRIF-------YSLRHTNILYW 279
            : |:|         :...|:.|..:...||..  .:..|||....:|       .:|....||.:
plant   239 T-FDP---------VARFLVSYQHFTYYPVMCFGRINLFIQTFLLLFSKREVPDRALNFAGILVF 293

  Fly   280 HDLLPLTIPIAIYLGTGGSLGIWICVRQW----------LAMTSIASFSFCLIGLNAAHHDPEIY 334
            ....||.:.               |:..|          ..:|::....|.|     .|...::|
plant   294 WTWFPLLVS---------------CLPNWPERFFFVFTSFTVTALQHIQFTL-----NHFAADVY 338

  Fly   335 HEGDANREDRDWGLFQVDTIID---RGDLKWSQFLVLTHFGD---HVLHHLFPTLDHGLLPALYP 393
            ......   .||...|....||   |..:.|       .||.   .:.|||||.|....|..:.|
plant   339 VGPPTG---SDWFEKQAAGTIDISCRSYMDW-------FFGGLQFQLEHHLFPRLPRCHLRKVSP 393

  Fly   394 VL----------YQTLDEFKGHLRECNHIE 413
            |:          |:::..|:.::...|.::
plant   394 VVQELCKKHNLPYRSMSWFEANVLTINTLK 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-b5-rNP_001260514.1 Cyt-b5 26..98 CDD:278597 22/75 (29%)
FA_desaturase 161..408 CDD:278890 64/332 (19%)
Membrane-FADS-like <328..385 CDD:294412 17/62 (27%)
SLD1NP_191717.1 Cyt-b5 11..82 CDD:395121 23/74 (31%)
Delta6-FADS-like 143..404 CDD:239583 58/303 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I2674
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1060606at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.