DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-b5-r and SLD2

DIOPT Version :9

Sequence 1:NP_001260514.1 Gene:Cyt-b5-r / 35008 FlyBaseID:FBgn0000406 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_182144.1 Gene:SLD2 / 819228 AraportID:AT2G46210 Length:449 Species:Arabidopsis thaliana


Alignment Length:455 Identity:108/455 - (23%)
Similarity:163/455 - (35%) Gaps:152/455 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ITTHSWQKGKRQDDGAEGLW-RINDGIYDFTSFIDKHPGGPFWIRETKGTDITEAFEAHHLTTA- 86
            :|:...:|..:..|    || .|...:||.:.::..||||...|....|.|:|:||.|:|..|| 
plant    10 VTSEDLKKHNKPGD----LWISIQGKVYDVSDWVKSHPGGEAAILNLAGQDVTDAFIAYHPGTAW 70

  Fly    87 --PEKMIAKYKVRD-------------AAE------------PRIYTLTLEEGGFYKTLKERVRE 124
              .||:...|.|||             |||            ..:||||.               
plant    71 HHLEKLHNGYHVRDHHVSDVSRDYRRLAAEFSKRGLFDKKGHVTLYTLTC--------------- 120

  Fly   125 QLKTIDKRPKKKSDLIHLGLVVSLYLLGIASAKYNSLLALVLASV--ALCW--TVIVSHNYFHR- 184
                             :|::::..|.|:.:.  .|:.|.::::|  .|.|  :..|.|:..|. 
plant   121 -----------------VGVMLAAVLYGVLAC--TSIWAHLISAVLLGLLWIQSAYVGHDSGHYT 166

  Fly   185 -------RDNWQMYAFN-LGMMNFAAWRVSHALSHHIYPNS------------------YFDLEL 223
                   ....|:.:.| |..::.|.|:.:|. :|||..||                  :|:...
plant   167 VTSTKPCNKLIQLLSGNCLTGISIAWWKWTHN-AHHIACNSLDHDPDLQHIPIFAVSTKFFNSMT 230

  Fly   224 S-------MFEPLLCWVPNPHIKSKLMRYVSWVTEPVAYA--LAFFIQMGTRIFYSLRH------ 273
            |       .|:||..:         |:.|..|...||...  :..|||....:| |.||      
plant   231 SRFYGRKLTFDPLARF---------LISYQHWTFYPVMCVGRINLFIQTFLLLF-SKRHVPDRAL 285

  Fly   274 --TNILYWHDLLPLTIPIAIYLGTGGSLGIWICVRQWLAMTSIASFSFCLIGLNAAHHDPEIYHE 336
              ..||.:....||.:.   :|.......|::.|.  .|:|:|....|||     .|...::| .
plant   286 NIAGILVFWTWFPLLVS---FLPNWQERFIFVFVS--FAVTAIQHVQFCL-----NHFAADVY-T 339

  Fly   337 GDANREDRDWGLFQVDTIID---RGDLKWSQFLVLTHFGD---HVLHHLFPTLDHGLLPALYPVL 395
            |..|  ..||...|....:|   |..:.|       .||.   .:.|||||.|....|..:.||:
plant   340 GPPN--GNDWFEKQTAGTLDISCRSFMDW-------FFGGLQFQLEHHLFPRLPRCHLRTVSPVV 395

  Fly   396  395
            plant   396  395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-b5-rNP_001260514.1 Cyt-b5 26..98 CDD:278597 25/75 (33%)
FA_desaturase 161..408 CDD:278890 69/289 (24%)
Membrane-FADS-like <328..385 CDD:294412 18/62 (29%)
SLD2NP_182144.1 Cyt-b5 11..82 CDD:395121 25/74 (34%)
Delta6-FADS-like 142..404 CDD:239583 68/285 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I2674
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1060606at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.