DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-b5-r and cyb5a

DIOPT Version :9

Sequence 1:NP_001260514.1 Gene:Cyt-b5-r / 35008 FlyBaseID:FBgn0000406 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_998300.2 Gene:cyb5a / 406409 ZFINID:ZDB-GENE-040426-2148 Length:137 Species:Danio rerio


Alignment Length:76 Identity:27/76 - (35%)
Similarity:39/76 - (51%) Gaps:9/76 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 INDGIYDFTSFIDKHPGGPFWIRETKGTDITEAFE-AHHLTTAPE----KMIAKYKVRD----AA 100
            |::.:||.|.|:::||||...:||..|.|.||:|| ..|.|.|.|    .:|.:....|    |.
Zfish    32 IHNKVYDVTKFLEEHPGGEEVLREQAGGDATESFEDVGHSTDAREMASSMLIGEVHPDDRDKIAK 96

  Fly   101 EPRIYTLTLEE 111
            .|.....|::|
Zfish    97 PPESLVTTVQE 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-b5-rNP_001260514.1 Cyt-b5 26..98 CDD:278597 22/57 (39%)
FA_desaturase 161..408 CDD:278890
Membrane-FADS-like <328..385 CDD:294412
cyb5aNP_998300.2 Cyt-b5 15..87 CDD:306642 22/54 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.