DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-b5-r and SPAC1F12.10c

DIOPT Version :9

Sequence 1:NP_001260514.1 Gene:Cyt-b5-r / 35008 FlyBaseID:FBgn0000406 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_594336.1 Gene:SPAC1F12.10c / 2541641 PomBaseID:SPAC1F12.10c Length:147 Species:Schizosaccharomyces pombe


Alignment Length:95 Identity:22/95 - (23%)
Similarity:35/95 - (36%) Gaps:20/95 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WKK--------SGIATKFPTYRNSALITTHSWQKGKRQDDGAEGLW-RINDGIYDFTSFIDKHPG 61
            |.|        ||:....|       :|.....|.|.::|    .| .|...:|:.::::..||.
pombe    55 WSKLVASGQNLSGVEKPIP-------VTKEELAKHKTKED----CWIAIRGKVYNVSAYLPYHPA 108

  Fly    62 GPFWIRETKGTDITEAFEAHHLTTAPEKMI 91
            |...|.:..|.|.|..|...|.....|.::
pombe   109 GQKRILDYAGRDATVIFMKFHAWVNEEALL 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-b5-rNP_001260514.1 Cyt-b5 26..98 CDD:278597 16/67 (24%)
FA_desaturase 161..408 CDD:278890
Membrane-FADS-like <328..385 CDD:294412
SPAC1F12.10cNP_594336.1 CYB5 21..>144 CDD:227599 22/95 (23%)
Cyt-b5 74..146 CDD:278597 17/69 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.