powered by:
Protein Alignment Cyt-b5-r and SPCC330.03c
DIOPT Version :9
Sequence 1: | NP_001260514.1 |
Gene: | Cyt-b5-r / 35008 |
FlyBaseID: | FBgn0000406 |
Length: | 436 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_587703.1 |
Gene: | SPCC330.03c / 2538811 |
PomBaseID: | SPCC330.03c |
Length: | 145 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 69 |
Identity: | 19/69 - (27%) |
Similarity: | 31/69 - (44%) |
Gaps: | 5/69 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 24 ITTHSWQKGKRQDDGAEGLW-RINDGIYDFTSFIDKHPGGPFWIRETKGTDITEAFEAHHLTTAP 87
:|.....|....|| .| .|...:|:.|:::..||.||..|.:..|.|.|:.:..||.....
pombe 72 VTAEELAKHCSPDD----CWMAIRGKVYNVTAYLPYHPVGPKKILKHSGVDATKPYLKHHDWVNE 132
Fly 88 EKMI 91
|:::
pombe 133 EELL 136
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
0 | 0.000 |
|
Return to query results.
Submit another query.