DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-b5-r and Fads2b

DIOPT Version :9

Sequence 1:NP_001260514.1 Gene:Cyt-b5-r / 35008 FlyBaseID:FBgn0000406 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_001075133.1 Gene:Fads2b / 228151 MGIID:2687041 Length:487 Species:Mus musculus


Alignment Length:437 Identity:98/437 - (22%)
Similarity:172/437 - (39%) Gaps:99/437 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ITTHSWQKGKRQDDGAEGLWRINDGIYDFTSFIDKHPGGPFWIRETKGTDITEAFEAHHLTTAPE 88
            :..::||:.:|....|:....|:..:|:.|.:..|||||...:....|.|.|:||.|.||.....
Mouse    62 LNLYTWQEIQRHSQEADQWLVIDRKVYNVTDWAGKHPGGRRVLNHYAGQDATDAFRAMHLDLGMV 126

  Fly    89 KMIAKYKVRDAAEPRIYTLTLEEGGFYKT----LKERVREQLKTIDKRPKKKSDL----IHLG-- 143
            |:..|..:       |..|:.||....|.    |.|..||..||::......::|    :||.  
Mouse   127 KLYLKPLL-------IGELSPEEPSQEKNKNAQLVEDFRELRKTLEAMNMFSANLRFFFLHLAQI 184

  Fly   144 --LVVSLYLL--GIASAKYNSLLALVLASVALCWTVIVSHNYFH----RRDNWQ--MYAF---NL 195
              |.:|.:|:  ...|:...::|...|.:|:......:.|:..|    ::..|.  |:.|   :|
Mouse   185 LILEISAWLILHHFGSSWLVTILISFLLTVSQAQCSFLQHDLGHLSMFKKSKWNHLMHKFVMCHL 249

  Fly   196 GMMNFAAWRVSHALSHHIYPNSY---FDLELSMFEPLLCWVPNPHIK--SKLMRYVSWVTEPVAY 255
            ..::...|...| ..||:.||.|   .|:::.   ||........||  .|.::|:.:..:.:.:
Mouse   250 KGLSADWWNYRH-FQHHVKPNIYPKDPDIDVG---PLFLVGDTQPIKYGKKKIKYIDYEKQHLYF 310

  Fly   256 ---ALAFFIQMGTRIFYSLRHTNIL----YWHDL-------LPLTIPIAIYLGTGGSLGIWICVR 306
               ||.|.:.    ::::|:...::    ||.|:       :...|....:.|..|::.:...|:
Mouse   311 YMVALPFLMP----VYFNLQSMQVMYLRKYWMDIAWVSSFYIRYFITFGPFYGIFGTVLLIYLVK 371

  Fly   307 ----QWLAMTSIASFSFCLIGLNAAHHDPEIYHEGDANREDRDWGLFQVDTIIDRGDLKWSQF-- 365
                .|:|..:..|            |.|...    ::.|:.||...||   :...:::.|.|  
Mouse   372 FIESPWIAYVTQMS------------HIPMKM----SSEENHDWLSTQV---VATCNIEQSFFND 417

  Fly   366 LVLTHFGDHVLHHLFPTL-----------------DHGLLPALYPVL 395
            ....|....:.||||||:                 .|||.....|:|
Mouse   418 WFTGHLNFQIEHHLFPTMPRHNYHKVAPLVKSLCAKHGLQYINKPIL 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-b5-rNP_001260514.1 Cyt-b5 26..98 CDD:278597 22/71 (31%)
FA_desaturase 161..408 CDD:278890 58/286 (20%)
Membrane-FADS-like <328..385 CDD:294412 16/75 (21%)
Fads2bNP_001075133.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Cyt-b5 64..138 CDD:278597 23/80 (29%)
FA_desaturase 201..459 CDD:278890 56/284 (20%)
Delta6-FADS-like 206..456 CDD:239583 54/276 (20%)
Histidine box-1 224..228 1/3 (33%)
Histidine box-2 261..265 1/4 (25%)
Histidine box-3 426..430 0/3 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I5430
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.