DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-b5-r and LOC105947186

DIOPT Version :9

Sequence 1:NP_001260514.1 Gene:Cyt-b5-r / 35008 FlyBaseID:FBgn0000406 Length:436 Species:Drosophila melanogaster
Sequence 2:XP_031756611.1 Gene:LOC105947186 / 105947186 -ID:- Length:152 Species:Xenopus tropicalis


Alignment Length:116 Identity:26/116 - (22%)
Similarity:47/116 - (40%) Gaps:36/116 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 MRYVSWVTEPVAYALAFFIQMGTRIFYSLRHTNILYWHDLLPLTIPIAIYLGTGGSLGIWICVRQ 307
            :|...|.  .:|:.::|:::.|           :.|        ||   :||..|::.:::.|| 
 Frog    38 IRRKKWA--DLAWMISFYVRFG-----------LCY--------IP---FLGVSGTIALFMVVR- 77

  Fly   308 WLAMTSIASFSFCLIGLNAAHHDPEIYHEGDANREDRDWGLFQVDTIIDRG 358
                 .|.|..|  :.:...:|.| :..:.|.|:|   |...||...|..|
 Frog    78 -----FIESNLF--VWVTQMNHIP-MNIDYDQNKE---WLSTQVPIHISDG 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-b5-rNP_001260514.1 Cyt-b5 26..98 CDD:278597
FA_desaturase 161..408 CDD:278890 26/116 (22%)
Membrane-FADS-like <328..385 CDD:294412 10/31 (32%)
LOC105947186XP_031756611.1 Membrane-FADS-like <36..>110 CDD:294412 22/107 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1060606at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.