DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mhc and AT5G20450

DIOPT Version :9

Sequence 1:NP_001162991.1 Gene:Mhc / 35007 FlyBaseID:FBgn0264695 Length:1962 Species:Drosophila melanogaster
Sequence 2:NP_001330932.1 Gene:AT5G20450 / 832167 AraportID:AT5G20450 Length:372 Species:Arabidopsis thaliana


Alignment Length:235 Identity:54/235 - (22%)
Similarity:100/235 - (42%) Gaps:37/235 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1544 EEAEAALEQEENKVLRAQLELSQVRQEIDRRIQEKEEEFENTRKNHQRALDSMQASLEAEAKGKA 1608
            |||:|.:.:|:....:|..|..||.:|    ..|..|:|.:....    :::::|||::|.:. |
plant     6 EEAKADVIREQETARKAIEEAPQVIKE----NSEDTEKFNSLTSE----VEALKASLQSERQA-A 61

  Fly  1609 EALRMKKKLEADINELEIALDHANKANAEAQKNIKRYQQQLKDI--QTALEEEQRARDDAREQLG 1671
            |.||.             |...|...|:|...|::...:::..:  ..:|:.||:|.:|.|:.|.
plant    62 EDLRN-------------AFSEAEARNSELATNLENVTRRVDQLCESASLQSEQQAAEDLRKALS 113

  Fly  1672 ISERRANALQNELEESRTLLEQADRGRRQAEQELADAHEQLNEVSAQNASISAAKRKLESELQ-- 1734
            ::|.|...|..:||.....::|.      .|.|   :.|.|.:..:||......|......:.  
plant   114 LAEARNLELTTKLENVTRRVDQL------CESE---SQEVLVKCISQNLGYDGGKPVAACVIYKC 169

  Fly  1735 TLHSDLDELLNEAKNSEEKAKKAMVDAARLADELRAEQDH 1774
            .||....|:  |..|..::..|.:..|..::|..:...::
plant   170 LLHWRSFEV--ERTNIFDRIVKIIASAIEVSDSYKVSDNN 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MhcNP_001162991.1 Myosin_N 36..73 CDD:280832
MYSc 81..777 CDD:214580
MYSc_Myh1_insects_crustaceans 100..765 CDD:276874
Myosin_tail_1 842..1897 CDD:279860 54/235 (23%)
V_Alix_like 1557..1877 CDD:187408 49/222 (22%)
ATP-synt_B <1671..1771 CDD:304375 21/101 (21%)
TMPIT 1739..>1825 CDD:285135 6/36 (17%)
AT5G20450NP_001330932.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000014
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.