DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mhc and LOC101884494

DIOPT Version :9

Sequence 1:NP_001162991.1 Gene:Mhc / 35007 FlyBaseID:FBgn0264695 Length:1962 Species:Drosophila melanogaster
Sequence 2:XP_005174715.1 Gene:LOC101884494 / 101884494 -ID:- Length:171 Species:Danio rerio


Alignment Length:171 Identity:80/171 - (46%)
Similarity:115/171 - (67%) Gaps:4/171 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DEDPTPYLFVSLEQRRIDQSKPYDSKKSCWIPDEKEGYLLGEIKATKGDIVSVGL--QGGEVRDI 72
            |.|...|:..:|....:.|: .:.:||..|:|.|:.|:..|.:|...||.|.|.|  .|.::| :
Zfish     3 DVDKFLYVDRNLVNNPLAQA-DWATKKLVWVPSERLGFEAGSLKEEHGDEVVVELADSGKKIR-V 65

  Fly    73 KSEKVEKVNPPKFEKIEDMADMTVLNTPCVLHNLRQRYYAKLIYTYSGLFCVAINPYKRYPVYTN 137
            ..:.::|:|||||.|:||||::|.||...|||||::|||:.|||||||||||.|||||..|:|:.
Zfish    66 NKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVVINPYKNLPIYSE 130

  Fly   138 RCAKMYRGKRRNEVPPHIFAISDGAYVDMLTNHVNQSMLIT 178
            ....||:||:|:|:||||:||:|.||..|:.:..:||:|.|
Zfish   131 EIVDMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCT 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MhcNP_001162991.1 Myosin_N 36..73 CDD:280832 14/38 (37%)
MYSc 81..777 CDD:214580 59/98 (60%)
MYSc_Myh1_insects_crustaceans 100..765 CDD:276874 46/79 (58%)
Myosin_tail_1 842..1897 CDD:279860
V_Alix_like 1557..1877 CDD:187408
ATP-synt_B <1671..1771 CDD:304375
TMPIT 1739..>1825 CDD:285135
LOC101884494XP_005174715.1 Myosin_N 28..66 CDD:280832 14/38 (37%)
Motor_domain 93..>171 CDD:277568 45/77 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D47111at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.