DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk17 and asic1a

DIOPT Version :9

Sequence 1:NP_001285988.1 Gene:ppk17 / 35006 FlyBaseID:FBgn0032602 Length:431 Species:Drosophila melanogaster
Sequence 2:XP_021333995.1 Gene:asic1a / 791696 ZFINID:ZDB-GENE-040513-2 Length:614 Species:Danio rerio


Alignment Length:448 Identity:97/448 - (21%)
Similarity:156/448 - (34%) Gaps:130/448 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 CCIVVIVQL-------YECFAK----LYNPPISTHSYYSLNE----TIEMPSVTIC--------- 67
            ||:.|:..|       |.|..:    |..|.::     .|:|    .:..|:||||         
Zfish   161 CCLWVVFFLSSLTFLMYVCIDRIQFYLEYPHVT-----KLDEITTPVMVFPAVTICNLNSIRFSR 220

  Fly    68 ----------------------REPPYKE----EVLTRLSGGACPHPKYATCWMKYPFGEISLDE 106
                                  ||....|    |||...:......|::...|           |
Zfish   221 ITRNDLYHAGELLALLNSRHEVREAHLVEESVMEVLKSKTDFRSFKPRHFNMW-----------E 274

  Fly   107 FFENSTHDSGDTFV---FYG--LNEDKNNVVMNSSLHFYMGRCYTLRPKESA-KRVS----KAVG 161
            |:..:.||..|..:   |.|  ...:..:||...     .|:|||....|:. .|||    ...|
Zfish   275 FYNRTGHDIKDMLLSCQFRGSPCRPEDFSVVFTR-----YGKCYTFNSGETGPPRVSVKGGMGNG 334

  Fly   162 YSIML----EHSMLTTSVSDVDTGSVGWHVFIHDKKENFTEINMKGSGRVE--YVFVGVNEEIEI 220
            ..|||    :..:.....||..:...|..|.||.:.|. ..|:..|.|...  ..||...|:..:
Zfish   335 LEIMLDIQQDEYLPVWGESDESSFEAGIKVQIHSQDEP-PFIDQLGFGVAPGFQTFVSCQEQRLV 398

  Fly   221 KLQTQYFSNVQTREEACSDD--ENYSDLKCGEQCIWQDLADNMQCSGPWMHEIASEP-CNDSLSM 282
            .|...:.|...|..   |.|  ..||...|...|..:.|.:|..|.  .:|.....| |...|  
Zfish   399 YLPAPWGSCKSTPP---SSDYFRAYSISACRTDCETRYLVENCNCR--MVHMPGDAPYCTPVL-- 456

  Fly   283 RKLISDYKD--------VYENEDDFDCDCVQPCQSRIYT---TFIQ-----NRKAFNQPEPRTQI 331
                  ||:        :.|.:.|: |.|..||....|:   :|::     :.|...:...:::.
Zfish   457 ------YKECAHPALDFLVETDSDY-CSCETPCNITRYSKELSFVKIPSKASVKYLAKKYSKSEK 514

  Fly   332 YIYYTTKLISM---------IEERPSYDTTQFIADVGGSLGFLLGLSVLGLIGILEHM 380
            ||.....::.:         ||:|.:|:....:.|:||.:|..:|.|:|.::.:.:::
Zfish   515 YITENVMVLDVFFEALNYETIEQRKAYEVAGLLGDIGGQMGLFIGASILTILELFDYL 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk17NP_001285988.1 ASC 11..358 CDD:295594 90/424 (21%)
asic1aXP_021333995.1 ASC 136..582 CDD:322155 97/448 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586608
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.