DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk17 and SCNN1D

DIOPT Version :9

Sequence 1:NP_001285988.1 Gene:ppk17 / 35006 FlyBaseID:FBgn0032602 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001123885.2 Gene:SCNN1D / 6339 HGNCID:10601 Length:802 Species:Homo sapiens


Alignment Length:495 Identity:102/495 - (20%)
Similarity:178/495 - (35%) Gaps:139/495 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RDPAKLIRYLVLFACCIVVIVQLYECFAK-----LYNPPISTHSYYSLNETIEMPSVTICR-EPP 71
            |.|:.::|:|           :|.:.||:     |||        .:|::.....|.|:.| |||
Human   303 RRPSPVLRHL-----------ELLDEFARENIDSLYN--------VNLSKGRAALSATVPRHEPP 348

  Fly    72 Y---KEEVLTRLS----------------GGACPHPKYAT------CWMKYPFGEI--SLDEFFE 109
            :   :|..|.|||                ||.|.:..|.:      .|..:.:.:|  .|...:|
Human   349 FHLDREIRLQRLSHSGSRVRVGFRLCNSTGGDCFYRGYTSGVAAVQDWYHFHYVDILALLPAAWE 413

  Fly   110 NSTHDSGDTFVFYGLNEDKNNVVMNSSLHFY---MGRCYTLRPKESAKR--VSKAVGYSIMLE-- 167
            :| |.|.|.......:.|..:........|:   .|.|||:....:|:|  ::..||..:.:|  
Human   414 DS-HGSQDGHFVLSCSYDGLDCQARQFRTFHHPTYGSCYTVDGVWTAQRPGITHGVGLVLRVEQQ 477

  Fly   168 -HSMLTTSVSDV--------DTGSVGWHVF---------IHDKKENFTEINMKGSGRVEYVFVGV 214
             |..|.::::.:        .|..:|.|.|         |..:::   |::..||........|.
Human   478 PHLPLLSTLAGIRVMVHGRNHTPFLGHHSFSVRPGTEATISIRED---EVHRLGSPYGHCTAGGE 539

  Fly   215 NEEIEIKLQTQYFSNVQTREEACSDDENYSDLKCGEQCIWQDLADNMQCSGPWMHEI--ASEPCN 277
            ..|:|:...|.|     ||:            .|...|..|.:.:...| |.::|.:  .:|.|:
Human   540 GVEVELLHNTSY-----TRQ------------ACLVSCFQQLMVETCSC-GYYLHPLPAGAEYCS 586

  Fly   278 DSL------SMRKLISDYKDVYENEDDFDCDCVQPCQSRIY--------------------TTFI 316
            .:.      ...:|   |:|:..:.......|.:||:...:                    |...
Human   587 SARHPAWGHCFYRL---YQDLETHRLPCTSRCPRPCRESAFKLSTGTSRWPSAKSAGWTLATLGE 648

  Fly   317 QN--RKAFNQPEPRTQIYIYYTTKLISMIEERPSYDTTQFIADVGGSLGFLLGLSVLGLIGILEH 379
            |.  .::..|.....:|.|.|.......:||.|.|...|.::.:|.......|.|||.|:.:||.
Human   649 QGLPHQSHRQRSSLAKINIVYQELNYRSVEEAPVYSVPQLLSAMGSLCSLWFGASVLSLLELLEL 713

  Fly   380 M-----MLFFCGGFIKRMQQKEQAKLEANSEDGQSQTSDE 414
            :     :....||  :|:::...:...|:...|.|....|
Human   714 LLDASALTLVLGG--RRLRRAWFSWPRASPASGASSIKPE 751

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk17NP_001285988.1 ASC 11..358 CDD:295594 87/432 (20%)
SCNN1DNP_001123885.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..211
ENaC 219..784 CDD:273304 102/495 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 738..777 4/14 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152178
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.