DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk17 and SCNN1B

DIOPT Version :9

Sequence 1:NP_001285988.1 Gene:ppk17 / 35006 FlyBaseID:FBgn0032602 Length:431 Species:Drosophila melanogaster
Sequence 2:XP_016879014.1 Gene:SCNN1B / 6338 HGNCID:10600 Length:659 Species:Homo sapiens


Alignment Length:603 Identity:105/603 - (17%)
Similarity:177/603 - (29%) Gaps:225/603 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GY-WSETRAW-------------LFRDPAKLIRYLVLFACCIVVIVQLYECFAKLYNPPISTHSY 52
            || :.|...|             :...|.|...:.:|......::...:..|.:.|   :|....
Human    38 GYTYKELLVWYCDNTNTHGPKRIICEGPKKKAMWFLLTLLFAALVCWQWGIFIRTY---LSWEVS 99

  Fly    53 YSLN---ETIEMPSVTICREPPYK---------------EEVLTRLSGGACPHPKYA-----TCW 94
            .||:   :|::.|:||||...|:|               |.||.|:......|....     :.|
Human   100 VSLSVGFKTMDFPAVTICNASPFKYSKIKHLLKDLDELMEAVLERILAPELSHANATRNLNFSIW 164

  Fly    95 ---------MKYPFGEISLDEF----------------------------------------FEN 110
                     .:.|...:.||.|                                        |.:
Human   165 NHTPLVLIDERNPHHPMVLDLFGDNHNGLTSSSASEKICNAHGCKMAMRLCSLNRTQCTFRNFTS 229

  Fly   111 STHDSGDTFVFYGLN----------------------------EDKNNVVMNSSLHFYMGRCYTL 147
            :|....:.::....|                            |..|.....|..:.:.|.||..
Human   230 ATQALTEWYILQATNIFAQVPQQELVEMSYPGEQMILACLFGAEPCNYRNFTSIFYPHYGNCYIF 294

  Fly   148 RPKESAKRVSKA-----VGYSIMLEHSMLTTSVSDVD-----TGSVGWHVFIHDKKENFTEINMK 202
            ....:.|.:..|     .|..::|:       :...|     ..:.|..:.:|::: ::..|..:
Human   295 NWGMTEKALPSANPGTEFGLKLILD-------IGQEDYVPFLASTAGVRLMLHEQR-SYPFIRDE 351

  Fly   203 GSGRVEYVFVGVNEEI----------------------EIKLQTQYFS-----NVQTREEACSDD 240
            |.    |...|....|                      |:.:|..|..     ::|....:|..|
Human   352 GI----YAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQD 412

  Fly   241 ENYSDLKCG----------EQCIWQDLADNMQCSGPWMHEIA---------SEPCND-----SLS 281
            ....:..||          :.|..:|..|...|.......:|         .|.|||     ::|
Human   413 HMIRNCNCGHYLYPLPRGEKYCNNRDFPDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTIS 477

  Fly   282 MRKLISDYKD-----VYENEDDFDCDCVQPCQSRIYTTFIQNRKAFNQPEPRTQIYIYYTTKLIS 341
            |....|:..:     |...|.|         ||   |....:||..      .::.||:......
Human   478 MADWPSEASEDWIFHVLSQERD---------QS---TNITLSRKGI------VKLNIYFQEFNYR 524

  Fly   342 MIEERPSYDTTQFIADVGGSLGFLLGLSVLGLIGILEHMMLFFCGGFIKRM-------QQKEQAK 399
            .|||..:.:....::::||..||.:|.|||.||...|.::.|.....||.:       |::.|| 
Human   525 TIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVWITIIKLVALAKSLRQRRAQA- 588

  Fly   400 LEANSEDGQSQTSDETID 417
                |..|...|..|.::
Human   589 ----SYAGPPPTVAELVE 602

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk17NP_001285988.1 ASC 11..358 CDD:295594 80/512 (16%)
SCNN1BXP_016879014.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152142
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.