DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk17 and ASIC4

DIOPT Version :9

Sequence 1:NP_001285988.1 Gene:ppk17 / 35006 FlyBaseID:FBgn0032602 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_061144.4 Gene:ASIC4 / 55515 HGNCID:21263 Length:539 Species:Homo sapiens


Alignment Length:377 Identity:80/377 - (21%)
Similarity:143/377 - (37%) Gaps:82/377 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 PSVTICREPPYKEEVLT--------RLSGGACPHPK----YATCWMKYPFGEISLDEFFENSTHD 114
            |:||:|....::...|:        .|:|  .| ||    :....::||  |..:.:....:.|.
Human   113 PAVTLCNINRFRHSALSDADIFHLANLTG--LP-PKDRDGHRAAGLRYP--EPDMVDILNRTGHQ 172

  Fly   115 SGDTFV---FYGLNEDKNNVVMNSSLHFYMGRCYTLRPKESAKRVSKA----VGYSIML----EH 168
            ..|...   |.|.:...:|.   |.::...|:|||......:...|:|    .|..|||    |.
Human   173 LADMLKSCNFSGHHCSASNF---SVVYTRYGKCYTFNADPRSSLPSRAGGMGSGLEIMLDIQQEE 234

  Fly   169 SMLTTSVSDVDTGSVGWHVFIHDKKENFTEINMKGSGRVE--YVFVGVNEEIEIKLQTQYFSNVQ 231
            .:.....::..:...|..|.||.::|. ..|:..|.|...  ..||...|: .:....|.:.|.:
Human   235 YLPIWRETNETSFEAGIRVQIHSQEEP-PYIHQLGFGVSPGFQTFVSCQEQ-RLTYLPQPWGNCR 297

  Fly   232 TREEACSDD-ENYS-------DLKCGEQCIWQDLADNMQCSGPWMHEIASEPCNDSLSMRKL--- 285
            ...|....: :.||       .|:|.::.:.|      :|....:|    .|.|:::....:   
Human   298 AESELREPELQGYSAYSVSACRLRCEKEAVLQ------RCHCRMVH----MPGNETICPPNIYIE 352

  Fly   286 ISDYK-DVYENEDDFDCDCVQPCQ-----SRIYTTFIQNR-------KAFNQPEPRTQIYI---- 333
            .:|:. |......:..|.|..||.     ..|....|.||       :.:|    |.:.||    
Human   353 CADHTLDSLGGGPEGPCFCPTPCNLTRYGKEISMVRIPNRGSARYLARKYN----RNETYIRENF 413

  Fly   334 -----YYTTKLISMIEERPSYDTTQFIADVGGSLGFLLGLSVLGLIGILEHM 380
                 ::.......:|:|.:|..:..:.|:||.:|..:|.|:|.|:.||:::
Human   414 LVLDVFFEALTSEAMEQRAAYGLSALLGDLGGQMGLFIGASILTLLEILDYI 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk17NP_001285988.1 ASC 11..358 CDD:295594 70/353 (20%)
ASIC4NP_061144.4 ASC 40..488 CDD:413546 80/377 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152196
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.