DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk17 and ppk20

DIOPT Version :9

Sequence 1:NP_001285988.1 Gene:ppk17 / 35006 FlyBaseID:FBgn0032602 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_651705.2 Gene:ppk20 / 43486 FlyBaseID:FBgn0039676 Length:587 Species:Drosophila melanogaster


Alignment Length:250 Identity:52/250 - (20%)
Similarity:92/250 - (36%) Gaps:63/250 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 FSNVQTREEACSDDENYSD----LKCGEQCIWQDLADNMQCSGP----WMHEIASEPCNDSLSMR 283
            |::.|...:|....:|:..    ..|..:|....|.....||.|    :.|.:..  || ::|:|
  Fly   346 FADEQGELDANDSAKNFGKPFQLSNCLNRCHESYLIQLCNCSLPIFFLYNHRVPD--CN-AVSLR 407

  Fly   284 KLISDYKDV--YENEDDFD-----------CDCVQPCQSRIY--TTFIQNRKAFNQP-EPRTQIY 332
             .::.:.|:  |:...|.|           |.|:..|....|  :|......|...| :|..:::
  Fly   408 -CLARHNDIFSYDKRRDEDALFSATKLGMTCSCLVDCYLLDYYTSTTTLPLSAHKLPKDPHQKLF 471

  Fly   333 ---IYYTTKLISMIEERPSYDTT------QFIADVGGSLGFLLGLSVLG--------LIGILEHM 380
               ::|      .:|..|.|.|:      ..||::||..|..||.|::.        .:|:..|:
  Fly   472 RVDVHY------QVETTPLYRTSLEFTIIDLIANLGGIFGLCLGASMVSAFELIYYLTVGLAMHL 530

  Fly   381 MLF-FCGGFIKRMQQK----------EQAKLEANSEDGQSQTSDETIDVEIAYKK 424
            ... :.|...|.::.|          |...| |.:......|:|..:.....|:|
  Fly   531 YDHQYYGVLFKHLKAKWVNLKGYLRNEVGHL-AENPAAHKDTNDRKLRHPFNYRK 584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk17NP_001285988.1 ASC 11..358 CDD:295594 34/163 (21%)
ppk20NP_651705.2 ASC 34..521 CDD:279230 40/184 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.