DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk17 and ppk21

DIOPT Version :9

Sequence 1:NP_001285988.1 Gene:ppk17 / 35006 FlyBaseID:FBgn0032602 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_651704.2 Gene:ppk21 / 43485 FlyBaseID:FBgn0039675 Length:550 Species:Drosophila melanogaster


Alignment Length:498 Identity:100/498 - (20%)
Similarity:166/498 - (33%) Gaps:157/498 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KLIRYLVLFAC---CIVVIVQLYECFAKLYNPPISTHSYYSLNETIEMPSVTICREP-PYKEEVL 77
            ::|..|:|...   .|||.|.|.|.:..:           .:..||:...:.|.|.| |      
  Fly    75 RVIWLLILLTTSIGAIVVYVDLNELYQTV-----------RIQTTIKNTMLPIFRIPFP------ 122

  Fly    78 TRLSGGACPHPKYATCWMKYPFGEI-SLDEFF-ENSTHDSGDTFVFY----------GLNEDKN- 129
               |.|.||..:     :.:...|. ::|.|. .|.:....|.||.:          .|||..| 
  Fly   123 ---SIGLCPRNR-----LNWKILETEAVDHFLGANVSAAQKDLFVKFFTAAGDPHLSRLNEMSNF 179

  Fly   130 --NVVMNSSLH------------FYMGRC----YTLRPKESAKRVSKAVGYSIMLEHSM---LTT 173
              |..:...||            |...||    :|.|.:.:.....:.:.|. ..|..:   ..|
  Fly   180 FGNKTLTDELHMLDHLDLREVYKFIQFRCQDLFHTCRWRGNPVNCCEVIEYQ-FTEAGLCFVFNT 243

  Fly   174 SVSDVDTGSVGWHVFIHDKKENFTEINMKGSG-----RVEYVFV-----GVNEEIEIKLQTQYFS 228
            .:|...........:...:..::.|    |||     |:...|:     |:|..|:   |.|.:|
  Fly   244 EISPASRQKAREDKYYPLRTPHYGE----GSGLDLFLRLNRSFIRPGKRGINVMIK---QPQQWS 301

  Fly   229 NV-----------------------QTR------EEACSDDE-------NYSDLK-----CGEQC 252
            :|                       :||      ......||       |:.|.:     |..:|
  Fly   302 DVVRHVPHEAHTRISITPRFTVTDERTRTVTPEIRRCIFGDEVDNPHYKNFPDFEYWVGNCRSRC 366

  Fly   253 IWQDLADNMQCSGPWMHEIASEPCNDSLSMRKLISDYKDVYEN-----------EDDF------- 299
            ..:.:.:..:||......|:.:   |:.:..| .||:|.:|:|           ||||       
  Fly   367 HQEHVLNLCKCSPSIFFPISDK---DNFTACK-ASDFKCLYDNRFTFSIERHPEEDDFVKNPFKE 427

  Fly   300 --DCDCVQPCQ----SRIYTTFIQNRKAFNQPEPRTQIYIYYTTKLISMIEERPSYDTTQFIADV 358
              .|||...|.    .|::||...:....:......::.|:|.:......:....:...:.:|..
  Fly   428 SMICDCFTSCSQLVFDRVFTTTTLDNNETDTEAGTMRLDIFYQSGWFIQYQTNMRFTFVELLASF 492

  Fly   359 GGSLGFLLGLSVLGLIGILEHMMLFFCGGFI----KRMQQKEQ 397
            ||.:|..||.|   |:...|....|..|.::    ||..:|.:
  Fly   493 GGIIGLFLGAS---LLSAFELAYYFSIGLYLYIHGKRKLRKPE 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk17NP_001285988.1 ASC 11..358 CDD:295594 87/453 (19%)
ppk21NP_651704.2 ASC 51..513 CDD:279230 95/477 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.