DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk17 and asic1b

DIOPT Version :9

Sequence 1:NP_001285988.1 Gene:ppk17 / 35006 FlyBaseID:FBgn0032602 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_999956.1 Gene:asic1b / 407672 ZFINID:ZDB-GENE-040513-1 Length:557 Species:Danio rerio


Alignment Length:426 Identity:82/426 - (19%)
Similarity:145/426 - (34%) Gaps:103/426 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 ETIEMPSVTICREPPYKEEVLT---------------RLSGG--ACPHPKYATCWMKYPFGEISL 104
            :.:..|::|:|....::...|:               .::.|  ..|.|....       ...||
Zfish   132 KNMTFPAITLCNYNTFRRSQLSYSDLLFMGPLLGYEDNMAPGIPLAPEPDRQG-------SRFSL 189

  Fly   105 DEFFENSTHDSGDTFVFYGLNEDKNNVVMNSSLHFYMGRCYTL------RPKESAKRVSKAVGYS 163
            .|||..:.|...|..:.......:........:....|:|||.      ||.....:.....|..
Zfish   190 AEFFNRTRHRMDDMLLECNFAGKECGAEHWREIFTRYGKCYTFNSGQDGRPLLITTKGGMGNGLE 254

  Fly   164 IML----EHSMLTTSVSDVDTGSVGWHVFIHDKKENFTEINMKGSGRVEYVFVGVNEEIEIKLQT 224
            |||    :..:.....:|..|...|..|.||.:.|. ..|:..|.|      |....:..:..|.
Zfish   255 IMLDIQQDEYLPVWGETDETTFEAGIKVQIHTQDEP-PFIDQLGFG------VAPGFQTFVSCQE 312

  Fly   225 QYFSNVQTREEAC------SDDEN-YSDLKCGEQCIWQDLADNMQC-----------SGPWMHEI 271
            |..:.:......|      ||..| ||...|...|..:.|.:|..|           ..|..::.
Zfish   313 QRLTYLPPPWGDCKATPIDSDFFNTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKE 377

  Fly   272 ASEPCNDSLSMRKLISDYKDVYENEDDFDCDCVQPCQSRIY---TTFIQ-----NRKAFNQPEPR 328
            .::|..|.|            .|.::|: |.|..||....|   .:|::     :.|...:...:
Zfish   378 CADPALDFL------------VERDNDY-CVCETPCNMTRYGKELSFVRIPSKASAKYLAKKYNK 429

  Fly   329 TQIY---------IYYTTKLISMIEERPSYDTTQFIADVGGSLGFLLGLSVLGLIGILEHM---- 380
            |:.|         |::.......||::.:|:....:.|:||.:|..:|.|:|.::.:.:::    
Zfish   430 TEQYISDNIMVLDIFFEALNYETIEQKKAYELAGLLGDIGGQMGLFIGASILTILELFDYLYEVI 494

  Fly   381 --MLFFCGGFIKRMQQKEQAKLEANSEDGQSQTSDE 414
              .|..|.   |:..|:..     |:|.|...:.|:
Zfish   495 KFKLCRCA---KKKHQRSN-----NNERGAVLSLDD 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk17NP_001285988.1 ASC 11..358 CDD:295594 67/362 (19%)
asic1bNP_999956.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..57
ASC 66..548 CDD:295594 82/426 (19%)
Selectivity filter. /evidence=ECO:0000305 477..479 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586663
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.