DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk17 and ASIC2

DIOPT Version :9

Sequence 1:NP_001285988.1 Gene:ppk17 / 35006 FlyBaseID:FBgn0032602 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_899233.1 Gene:ASIC2 / 40 HGNCID:99 Length:563 Species:Homo sapiens


Alignment Length:482 Identity:86/482 - (17%)
Similarity:155/482 - (32%) Gaps:152/482 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PISTHSYYSLNETIEMPSVTICREPPYKEEVLTRLSGGACPHPKYATCWM--------------- 95
            |..|..:...:..:..|:||:|...|.:   ..|||.|..   .||..|:               
Human   115 PSHTRVHREWSRQLPFPAVTVCNNNPLR---FPRLSKGDL---YYAGHWLGLLLPNRTARPLVSE 173

  Fly    96 --------KYPFGEISLDEFFENSTHDSGDTFVFYG-LNEDKNNVVMN-------------SSLH 138
                    :..|.:::....|....|..|.:..|.. |.....:::::             ||:.
Human   174 LLRGDEPRRQWFRKLADFRLFLPPRHFEGISAAFMDRLGHQLEDMLLSCKYRGELCGPHNFSSVF 238

  Fly   139 FYMGRCYTLRPKESAKRVSKAV------GYSIML----EHSMLTTSVSDVDTGSVGWHVFIHDKK 193
            ...|:||.....|..|.:...|      |..|||    :..:.....::..|...|..|.||.:.
Human   239 TKYGKCYMFNSGEDGKPLLTTVKGGTGNGLEIMLDIQQDEYLPIWGETEETTFEAGVKVQIHSQS 303

  Fly   194 ENFTEINMKGSGRVEYVFVGVNEEIEIKLQTQYFSNVQTREE----------ACSDDEN------ 242
            |.              .|:   :|:...:...:.:.|.|:|:          .|...|.      
Human   304 EP--------------PFI---QELGFGVAPGFQTFVATQEQRLTYLPPPWGECRSSEMGLDFFP 351

  Fly   243 -YSDLKCGEQCIWQDLADNMQC-----------SGPWMHEIASEPCNDSLSMRKLISDYKDVYEN 295
             ||...|...|..:.:.:|..|           ..|..|:..:||....|:            |.
Human   352 VYSITACRIDCETRYIVENCNCRMVHMPGDAPFCTPEQHKECAEPALGLLA------------EK 404

  Fly   296 EDDFDCDCVQPCQSRIY------------TTFIQNRKAFNQPEPRTQ-----IYIYYTTKLISMI 343
            :.:: |.|..||....|            |:.....|.||:.|....     :.|::.......|
Human   405 DSNY-CLCRTPCNLTRYNKELSMVKIPSKTSAKYLEKKFNKSEKYISENILVLDIFFEALNYETI 468

  Fly   344 EERPSYDTTQFIADVGGSLGFLLGLSVLGLIGILEHMMLFFCGGFIKRMQQKEQAKLEANSED-- 406
            |::.:|:....:.|:||.:|..:|.|:|.::.:.:         :|..:.:::...|....||  
Human   469 EQKKAYEVAALLGDIGGQMGLFIGASILTILELFD---------YIYELIKEKLLDLLGKEEDEG 524

  Fly   407 -------------GQSQTSDETIDVEI 420
                         ..|:|...|::|.:
Human   525 SHDENVSTCDTMPNHSETISHTVNVPL 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk17NP_001285988.1 ASC 11..358 CDD:295594 71/403 (18%)
ASIC2NP_899233.1 ENaC 64..547 CDD:273304 84/476 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152152
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.