DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk17 and ppk27

DIOPT Version :9

Sequence 1:NP_001285988.1 Gene:ppk17 / 35006 FlyBaseID:FBgn0032602 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_647826.2 Gene:ppk27 / 38440 FlyBaseID:FBgn0035458 Length:422 Species:Drosophila melanogaster


Alignment Length:417 Identity:83/417 - (19%)
Similarity:142/417 - (34%) Gaps:104/417 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YWSETRAWLFRDPAKLIRYLVLFACCIVVIVQL----YECFAKLYNPPISTHSYYSLNETIEMPS 63
            :|     :||      |.:.:|||...|..:.|    |...|.|....:       |.:.|..|.
  Fly    39 FW-----FLF------ISFGILFASYAVFSMVLEFLSYSTIADLSELKV-------LEDEIHFPE 85

  Fly    64 VTICREPPYKEEVLTRLSGG---ACPHPKYATCWMKYPFGEIS-LDEFFE------------NST 112
            :.||  ..||......|:..   .....|....|:    .::| |..:|:            ||.
  Fly    86 LKIC--SGYKFSYRNMLASAHDLVSSQNKSLDYWL----NKLSLLSGYFDALSVKAENVDDLNSL 144

  Fly   113 HDSGDTFVF-YGLNEDKNNVVMNSSLHFYMGRC---YTLRPKESAKRVSKAVGYSIMLEHSMLTT 173
            .|..:...| ..|.....::::...|:.....|   :||:....        |...:|.:|.||.
  Fly   145 LDIKNISSFLLALTPACESLILKCKLNNIPANCLKLFTLKAYND--------GNCCVLRNSNLTG 201

  Fly   174 SVSDVDTGSVGWHVFIHDKKENFTEINMKGS------------GRVEYVFVGVNEEIEIKLQTQY 226
            .::          :|:...:  ..|..:.|:            |||. :..|....:||::. :.
  Fly   202 ELT----------LFMDSSQ--IDEYPLNGNLPGFSLHVPSWQGRVS-INPGEMAAVEIEVM-EL 252

  Fly   227 FSNVQTRE-----EAC-SDDENYSDLKCGEQCIWQDLADNMQCSGPWMHEIASEP---CN-DSLS 281
            ..|.|..|     .|| ...|..|..||..:|..:....|.||. |:..|..::.   |. :::.
  Fly   253 QGNSQLNEYAVEKRACYFSQEGESREKCLHECRIKATLINCQCV-PYPFEFRTQKFGYCTLENIR 316

  Fly   282 MRKLISDYKDVYENEDDFDC-DCVQPCQSRIYTTFIQNRKAFNQPEP-RTQIYIYYTTKLISMIE 344
            ..:|:.      .|.....| .|:..|....|..   |::......| |:::...:.|......:
  Fly   317 CLQLVE------RNWSPAQCPQCLPLCNQLFYRL---NKQILGHLHPWRSELNFKFKTPHRQRYK 372

  Fly   345 ERPSYDTTQFIADVGGSLGFLLGLSVL 371
            ....|...|.:::|||.||..:|.|.:
  Fly   373 TNILYHWYQMLSNVGGVLGICIGCSFI 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk17NP_001285988.1 ASC 11..358 CDD:295594 75/394 (19%)
ppk27NP_647826.2 ASC 15..407 CDD:279230 83/417 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.