DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk17 and Gr59e

DIOPT Version :9

Sequence 1:NP_001285988.1 Gene:ppk17 / 35006 FlyBaseID:FBgn0032602 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_788431.1 Gene:Gr59e / 37725 FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster


Alignment Length:128 Identity:27/128 - (21%)
Similarity:46/128 - (35%) Gaps:51/128 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 IWQDLADNMQCSGPWMHEIASEPCNDSLSMRKLISDYKDVYENEDDFDCDCVQPCQSRIYTT--- 314
            ||..|:.|.|        |..:.||    :.:|:::               ::.|.||:..|   
  Fly   299 IWFILSVNEQ--------ILEQKCN----LCQLLNE---------------LEVCSSRLQRTINR 336

  Fly   315 -FIQNRKAFNQPEPRTQIYIYYTTKLISMIEERPSYDTTQFIADVGGSLGFLLGLSVLGLIGI 376
             .:|.:::.:||.....|....|..|                   ||.:|.|:.: |:.||.|
  Fly   337 FLLQLQRSIDQPLEACGIVTLDTRSL-------------------GGFIGVLMAI-VIFLIQI 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk17NP_001285988.1 ASC 11..358 CDD:295594 19/108 (18%)
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 27/128 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.