DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk17 and ppk7

DIOPT Version :9

Sequence 1:NP_001285988.1 Gene:ppk17 / 35006 FlyBaseID:FBgn0032602 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_609016.2 Gene:ppk7 / 33886 FlyBaseID:FBgn0031802 Length:573 Species:Drosophila melanogaster


Alignment Length:465 Identity:84/465 - (18%)
Similarity:151/465 - (32%) Gaps:145/465 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 YECFAKLYNPPISTHSYYSLNETIEMPSVTICREPPYKEEVLTRLSGGACPHPKYATCWMKYPFG 100
            ::.|.:|.|.|....:|.:.::.::..:.. |.|  ...|.|.|       |..|..|       
  Fly   157 FQSFERLRNQPTELLNYVNFSQVVDFMTWR-CNE--LLAECLWR-------HHAYDCC------- 204

  Fly   101 EISLDEFFENSTHDSGDTFVFYGLNEDKNNVVMNSSLHFYMGRCYTLRP----KESAKRVSKAVG 161
                 |.|......:|..:.|..|..::..            |...|.|    :..:.....|:.
  Fly   205 -----EIFSKRRSKNGLCWAFNSLETEEGR------------RMQLLDPMWPWRTGSAGPMSALS 252

  Fly   162 YSIMLEHS------MLTTSVSDVD---TGSVGWHVFIHDKKENFTEINMKGSGRVEYVFVGVNEE 217
            ..::::.:      ..|.::..:|   |....||      ...|              ||..|.|
  Fly   253 VRVLIQPAKHWPGHRETNAMKGIDVMVTEPFVWH------NNPF--------------FVAANTE 297

  Fly   218 --IEIKLQTQYFSN----VQTREEAC--SDDENYSDLKCGEQCIWQDLADNMQCSGPWMHEIASE 274
              :||:....::.|    |::.:..|  .|:.|..|.|..:..::  :.:|  |......|....
  Fly   298 TTMEIEPVIYFYDNDTRGVRSDQRQCVFDDEHNSKDFKSLQGYVY--MIEN--CQSECHQEYLVR 358

  Fly   275 PCNDSLSM--------------RKLISDYKD--VYEN---EDDF--------DCDCVQPCQSRIY 312
            .||.::.:              ...::::.|  :|.:   |.:|        .|.|.:.|.|..|
  Fly   359 YCNCTMDLLFPPGQYRSCRAQDLLCLAEHNDLLIYSHNPGEKEFVRNQFQGMSCKCFRNCYSLNY 423

  Fly   313 TTFIQNRKAFNQPEP-------------RTQIYIYYTTKLISMIEERPSYDTTQFIADVGGSLGF 364
            .:.:  |.||..|:.             |.:..:.|.|.|:        :.....:...||..|.
  Fly   424 ISDV--RPAFLPPDVYANNSYVDLDVHFRFETIMVYRTSLV--------FGWVDLMVSFGGIAGL 478

  Fly   365 LLGLSVLGLIGILEHMMLFFC--------GGFIKRMQQKEQAKLEAN----SEDGQSQTSDETID 417
            .||.|   ||..:| :..|.|        .|..:|.:.:.|..|...    :.:.|..|..:.::
  Fly   479 FLGCS---LISGME-LAYFLCIEVPAFGLDGLRRRWKARRQMDLGVTVPTPTLNFQQTTPSQLME 539

  Fly   418 VEIAYKKKEK 427
            ..|...|.||
  Fly   540 NYIMQLKAEK 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk17NP_001285988.1 ASC 11..358 CDD:295594 63/382 (16%)
ppk7NP_609016.2 ASC 38..493 CDD:279230 72/407 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.