DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk17 and ppk23

DIOPT Version :9

Sequence 1:NP_001285988.1 Gene:ppk17 / 35006 FlyBaseID:FBgn0032602 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001097011.1 Gene:ppk23 / 32731 FlyBaseID:FBgn0030844 Length:591 Species:Drosophila melanogaster


Alignment Length:492 Identity:98/492 - (19%)
Similarity:165/492 - (33%) Gaps:145/492 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IVVIVQLYECFAKLYNPPISTHSYYSLNETIEMPSVTICREPPYK-----EEVLTRLSGGACPHP 88
            :|:|:.|:|.|..  ||.|:.......|:.:..|:..:|.|..:.     |:|...|:       
  Fly    71 LVIIMSLWEKFQT--NPTITGLDTDFHNQNVVFPTTVVCPEAAFDHDKTYEKVYNTLA------- 126

  Fly    89 KY--ATCWMKYPFGEISLDEFFENSTHDSGDTFVFYGLNEDKNNVVMNSSLHFYMGRCYTLRP-- 149
            .|  |...|..||..|.....|||.                ::..|::.|:...:...:|:|.  
  Fly   127 NYDEAQAQMYTPFLRILTSLNFENV----------------RDAKVLSQSIPQNLLDAHTIREWA 175

  Fly   150 ---KESAKRVSKAVGY------------SIMLEHSML--------TTSVSDVDTGSVGWH-VFIH 190
               ....|.|..:..|            .|..||...        :|...||.||:.  | ::..
  Fly   176 FEGHIDCKNVFVSCKYRDEDIPCCDHFEPIYTEHGFCYAFNSRFKSTPTEDVKTGAP--HDLYET 238

  Fly   191 DKK------ENFTEINMKGSGRVEYVFVGVNEE-----------------IEIKLQTQYFSNVQT 232
            |||      .|.|          ..:|:..|||                 :|:::..:   |..|
  Fly   239 DKKWALFFIPNST----------SRIFIFSNEEYFGSDFNAQIDWSEPQLVEVRISKK---NTYT 290

  Fly   233 REEA---------C--SDD-------ENYSDLKCGEQCIWQDLADNMQCSGPWMHEIASEPCNDS 279
            .::|         |  ||:       :.|:...|.:||.........:|:.|:...|....|..:
  Fly   291 TDDARQLSIGQRKCIFSDEVKLNYFPDAYTFSSCMKQCRMNKAIKLCKCNPPFYKPIRELSCVIN 355

  Fly   280 LSMRKLISDYKDVYENE---------DDFDC------------DCVQPCQSRIYTTFIQNR--KA 321
            : ...||:....:|...         .||||            ||:|...|...|.|..::  |.
  Fly   356 I-FTNLIAYILLLYLTPKANVPMCSIKDFDCLDEFKSNITNIKDCLQCELSCSKTVFNIDKLIKM 419

  Fly   322 FNQPEPRTQIYIYYTTKLISMIEERPSYDTTQFIADVGGSLGFLLGLSVLGLIGILEHMMLFFCG 386
            .::|| ...:.:.:.|..|...:....:.....:...||.....||.|:|..:.|:.:..|..|.
  Fly   420 SDRPE-SLGVLVEFLTWPIIRYKREVLFGWVDLLVSFGGIASLFLGFSLLSGVEIIYYFTLRACC 483

  Fly   387 GFIKRMQQKEQAKLEANSEDGQSQTSDETIDVEIAYK 423
            ...|..|:..:.      |:...|.....||::::.|
  Fly   484 MVYKNRQELYEI------EEKIRQEPPPKIDLKLSLK 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk17NP_001285988.1 ASC 11..358 CDD:295594 82/425 (19%)
ppk23NP_001097011.1 ASC 34..476 CDD:279230 89/446 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.