DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk17 and ppk3

DIOPT Version :9

Sequence 1:NP_001285988.1 Gene:ppk17 / 35006 FlyBaseID:FBgn0032602 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_726336.1 Gene:ppk3 / 246504 FlyBaseID:FBgn0050181 Length:535 Species:Drosophila melanogaster


Alignment Length:430 Identity:81/430 - (18%)
Similarity:139/430 - (32%) Gaps:115/430 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PISTHSYY------SLNETI-EMPSVTICREP-----PYKEEVLTRLSGGACPHPKYATCWMKYP 98
            |..|..||      ..||.| ||.:|:|..|.     .:...|:...:|......|:|.   ...
  Fly   114 PAVTLCYYDHIDSFKANEYIQEMWNVSIIDEDYFYFMDFLYAVVNATAGNYAELAKFAE---DER 175

  Fly    99 FGEISLDEFFEN---------STHDSG----------DTFVFYGLNEDKNNVVMNSSLHFYMGRC 144
            |.:|.|.|..:.         |:.|:|          :....|.:|...:.|:....:      .
  Fly   176 FDQIDLYEMIQRVDRPFEQVISSFDAGFQVHVQRVMTERGACYAINSPMSTVLSGQPV------A 234

  Fly   145 YTLRPKESAKRVSKAVGY---------SIMLEHSMLTTSVSDVDTGSVGWHVFIHDKKENFTEIN 200
            |.|.|:..:.:..|...|         .::..||....|.::.:.      |.:|...|      
  Fly   235 YELMPQPLSCQYGKQQCYIRMDLYESTGVLDVHSPFEVSATEANI------VALHKSDE------ 287

  Fly   201 MKGSGRVEYVFVGVN-EEIEIKLQTQYFSNVQTREEACSDDENYSDLKCGEQCIWQDLADNMQCS 264
            :..|.:|.......| .::.:..:...|:|.:|     |:.:.||...|..:|......:...|.
  Fly   288 ITASFKVLETVASKNLRQLSVAQRKCVFNNEET-----SNLKIYSKSLCLARCRAVMALEMCNCV 347

  Fly   265 GPWMHEIASEP-CNDSLSMRKLISDYKDVYENEDDFD--------CDCVQPCQSRIYTT------ 314
             |:.:.....| ||.:            .:|...||.        |.|...|....||.      
  Fly   348 -PFFYPYVDGPSCNPA------------GFECLLDFKWPIWALHICKCPSTCTEIEYTMQTVKKS 399

  Fly   315 --FIQNRKAFNQPEPRTQIYIYYTTKLISMIEERPSYDTTQFIADVGGSLGFLLGLSVLGLIGI- 376
              .::|.:.....|..|..:.:........:.....|.....:...||.|...:|:||:||:.: 
  Fly   400 SWGVKNNEEVASSETATSSFRWDLIPPKVRMRRDVVYSFEDLVVSFGGVLALFVGVSVMGLVEMV 464

  Fly   377 -------------LEHMMLFFCGGFIKRMQQKEQAKLEAN 403
                         |..:||    |.::|..:::....|||
  Fly   465 HVLVNNLLLDVFTLLRLML----GRLRRCWRRDDHMREAN 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk17NP_001285988.1 ASC 11..358 CDD:295594 65/369 (18%)
ppk3NP_726336.1 ASC 59..464 CDD:279230 73/388 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.