DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk17 and Scnn1g

DIOPT Version :10

Sequence 1:NP_609809.1 Gene:ppk17 / 35006 FlyBaseID:FBgn0032602 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_035456.1 Gene:Scnn1g / 20278 MGIID:104695 Length:655 Species:Mus musculus


Alignment Length:36 Identity:10/36 - (27%)
Similarity:14/36 - (38%) Gaps:4/36 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 HMLTHEGEGKRFACQD-CSKTFPNAIYLRDHFNRIH 73
            |:...|.....|..:: |...|.|   ||:.|...|
Mouse    79 HLFNKENLPGHFKFKEYCPLVFRN---LRERFGVEH 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk17NP_609809.1 ASC 22..358 CDD:459966 10/36 (28%)
Scnn1gNP_035456.1 ENaC 24..636 CDD:273304 10/36 (28%)
Gating release of inhibition by proteolysis (GRIP), protease-sensitive region that is responsible for the proteolytic activation of the channel. /evidence=ECO:0000305|PubMed:15007080, ECO:0000305|PubMed:18650438 140..227
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 582..636
PY motif, recruits WW domain-containing proteins and is thereby required for ubiquitination and inhibition of the channel by NEDD4 and NEDD4L. /evidence=ECO:0000250|UniProtKB:P51170 629..633
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.