| Sequence 1: | NP_609809.1 | Gene: | ppk17 / 35006 | FlyBaseID: | FBgn0032602 | Length: | 431 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_035456.1 | Gene: | Scnn1g / 20278 | MGIID: | 104695 | Length: | 655 | Species: | Mus musculus |
| Alignment Length: | 36 | Identity: | 10/36 - (27%) |
|---|---|---|---|
| Similarity: | 14/36 - (38%) | Gaps: | 4/36 - (11%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 39 HMLTHEGEGKRFACQD-CSKTFPNAIYLRDHFNRIH 73 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ppk17 | NP_609809.1 | ASC | 22..358 | CDD:459966 | 10/36 (28%) |
| Scnn1g | NP_035456.1 | ENaC | 24..636 | CDD:273304 | 10/36 (28%) |
| Gating release of inhibition by proteolysis (GRIP), protease-sensitive region that is responsible for the proteolytic activation of the channel. /evidence=ECO:0000305|PubMed:15007080, ECO:0000305|PubMed:18650438 | 140..227 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 582..636 | ||||
| PY motif, recruits WW domain-containing proteins and is thereby required for ubiquitination and inhibition of the channel by NEDD4 and NEDD4L. /evidence=ECO:0000250|UniProtKB:P51170 | 629..633 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||