DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk17 and egas-2

DIOPT Version :9

Sequence 1:NP_001285988.1 Gene:ppk17 / 35006 FlyBaseID:FBgn0032602 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_507640.2 Gene:egas-2 / 190561 WormBaseID:WBGene00013487 Length:919 Species:Caenorhabditis elegans


Alignment Length:325 Identity:66/325 - (20%)
Similarity:117/325 - (36%) Gaps:88/325 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 DSGDTFVFYGLNEDK----------NNVVMNSSLHFYMGRCYTLRPKES-----AKRVSKAVGYS 163
            |.||.|.:....:.:          |:||        :|.|:|...::.     .:|..:..|. 
 Worm   620 DVGDLFNWIAFEDQRLDLENDIYKWNDVV--------LGNCFTFNHQDQNFTYLMRRPGRHGGI- 675

  Fly   164 IMLEHSMLTTSVSD----VDTGSVGWHVFIHDKKENFTEINMKGSGRVEYVF-------VGVNEE 217
                .:.:.|...:    .||  .|..||||:              |.:|||       ...|.:
 Worm   676 ----QAFMKTRQDEYAPWYDT--AGMLVFIHN--------------REDYVFSESVRYNAQPNAQ 720

  Fly   218 IEIKLQTQYFSNVQTREEAC----SDDENY-------SDLKCGEQCIWQDLADNMQCSGPWMHEI 271
            ..|.:....::.:..|...|    |:.:||       :| .|...|....:....||..| .:..
 Worm   721 STINIFMTRYTRLGGRYGKCVKKPSEVKNYYYPGAYTTD-GCLRTCYQDRMQQECQCMDP-RYPK 783

  Fly   272 ASEPCNDSLSMRKLISDYKDVYENEDDF-DCDCVQPCQSRIYTTFIQNRKAFNQP---EPRTQIY 332
            |....:..||.|..:::..|...:...: .|.|..||.::.|:.........|.|   |..:.:.
 Worm   784 APNATSCQLSERSCVTEASDAAGDPSTWSSCVCPLPCSNQEYSVTWSKANFVNMPITCEKSSDVA 848

  Fly   333 I----YYTTKLISMI---------EERPSYDTTQFIADVGGSLGFLLGLSVLGLIGILEHMMLFF 384
            .    |....::|::         .|.|:.|..:|::.:||.||.|:|::   |:..:|.:.|.|
 Worm   849 TCQANYVDQLMVSIVLPKLDFQIYAETPAMDFNKFLSQLGGQLGVLMGIN---LVTFIEVVFLMF 910

  Fly   385  384
             Worm   911  910

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk17NP_001285988.1 ASC 11..358 CDD:295594 56/297 (19%)
egas-2NP_507640.2 ASC <650..908 CDD:279230 57/283 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.