DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk17 and degt-1

DIOPT Version :9

Sequence 1:NP_001285988.1 Gene:ppk17 / 35006 FlyBaseID:FBgn0032602 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_505703.3 Gene:degt-1 / 184921 WormBaseID:WBGene00009109 Length:852 Species:Caenorhabditis elegans


Alignment Length:349 Identity:65/349 - (18%)
Similarity:127/349 - (36%) Gaps:110/349 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RYL---------VLFACCIVVIVQL--YECFAKL----YNPPISTHSYYSLNETIEMPSVTICRE 69
            |||         ||:...:|..:.|  |:.|.::    ...|::|...|.....:..|::.:|.:
 Worm    54 RYLHTRYKTWFRVLWGFVVVFFIGLTFYQVFERVTYYFIKNPLTTRRSYETLPNMYFPTIGVCNK 118

  Fly    70 PPYKE---------------EVLTRLSGGACPHPKYATCWMKYPFGEISLDEFFENSTHDSGDTF 119
            ...|.               .||...|..:....:..      .|.::.:...:.||...:.|.|
 Worm   119 MQIKASSVASKNPDLLRGMCSVLDESSSNSSRFDELD------KFDDVDILSLYRNSFQSADDLF 177

  Fly   120 VF--YGLNEDKNNVVMNSSLHFY--MGRCYTLRPKESAKRVSKAVGYSIMLE---HSMLTTSVSD 177
            |.  :|    |:....:.....|  .|.||::.|.::..|.......|::|.   |.::..:|  
 Worm   178 VSCEFG----KSGSCQDEIRPIYTPFGLCYSVSPNKTILRPGPETTLSLVLNLEVHEIIPGTV-- 236

  Fly   178 VDTGSVGWHVFIHDKKENFTE----INMKGSGRVEYVFVGVNEEIEIKLQTQYFSNVQTREEACS 238
            |:.|.|   :.|:|...:.:.    |::: :|:|  |.:.|||..:::|          .|.:|.
 Worm   237 VEPGVV---LSIYDGASSLSHYSEGIHLE-AGKV--VTIPVNEVRKLRL----------HESSCG 285

  Fly   239 DD--ENYSDLKCGEQCIWQDLADNMQCSGPWMHEIASEPCNDSLSMRKLISDYKDVYENEDDFDC 301
            ..  |::|:                       .|.:...|..|:|::::            :.:|
 Worm   286 STKMESFSE-----------------------KEYSKAACEWSVSVKQI------------EKEC 315

  Fly   302 DCVQPCQSRIYTTFIQNRKAFNQP 325
            .|: |.::.||.....|:   |.|
 Worm   316 GCI-PIRNPIYRGVFDNK---NDP 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk17NP_001285988.1 ASC 11..358 CDD:295594 65/349 (19%)
degt-1NP_505703.3 ASC 44..>318 CDD:279230 58/326 (18%)
ASC <704..836 CDD:295594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.