DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk17 and mec-4

DIOPT Version :9

Sequence 1:NP_001285988.1 Gene:ppk17 / 35006 FlyBaseID:FBgn0032602 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_510712.2 Gene:mec-4 / 181728 WormBaseID:WBGene00003168 Length:768 Species:Caenorhabditis elegans


Alignment Length:329 Identity:78/329 - (23%)
Similarity:117/329 - (35%) Gaps:78/329 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 GRCYTLRPKESAKRVSKAVG--YSIMLEHSMLTTSVSDV--DTGSVGWHVFIHDKKENFTEINMK 202
            |.|:|.....:....|...|  |.:.:   ::..:.||.  .|.:.|..:.||| ||:|...:..
 Worm   472 GSCFTFNHNRTVNLTSIRAGPMYGLRM---LVYVNASDYMPTTEATGVRLTIHD-KEDFPFPDTF 532

  Fly   203 G-SGRVEYV-FVGVNEEIEIKLQTQYFSNV---QTREEACSDDENYSDLKCGEQCIWQDLADNMQ 262
            | |....|| ..|:......:|...|...|   :|.:...|:.| ||...|...|..|.:....:
 Worm   533 GYSAPTGYVSSFGLRLRKMSRLPAPYGDCVPDGKTSDYIYSNYE-YSVEGCYRSCFQQLVLKECR 596

  Fly   263 CSGPWM-------HEIASEPCNDSLSMRKLISDYKDVYENEDDFDCDCVQPCQSRIYT------- 313
            |..|..       |..|::|    ::.:.|.:...|:......|.|.|.|||:..||:       
 Worm   597 CGDPRFPVPENARHCDAADP----IARKCLDARMNDLGGLHGSFRCRCQQPCRQSIYSVTYSPAK 657

  Fly   314 ---------------TFIQNRKAFNQPEPRTQIYIYYTTKLISMIEERPSYDTTQFIADVGGSLG 363
                           |.::..|.:.  |....:.::|......|:.|..:|.....:||.||.||
 Worm   658 WPSLSLQIQLGSCNGTAVECNKHYK--ENGAMVEVFYEQLNFEMLTESEAYGFVNLLADFGGQLG 720

  Fly   364 FLLGLSVLGLIGILEHMMLFFCGGFIKRMQQKEQAKLEANSEDGQSQTSDETIDVEIAYKKK--E 426
            ...|:|.|   ...|.:.||.           |.|.:.|  |...|           .||||  |
 Worm   721 LWCGISFL---TCCEFVFLFL-----------ETAYMSA--EHNYS-----------LYKKKKAE 758

  Fly   427 KQPK 430
            |..|
 Worm   759 KAKK 762

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk17NP_001285988.1 ASC 11..358 CDD:295594 55/253 (22%)
mec-4NP_510712.2 deg-1 86..736 CDD:273309 64/277 (23%)
ASC 87..>172 CDD:279230
ASC <428..739 CDD:295594 66/291 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.