DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk17 and del-6

DIOPT Version :9

Sequence 1:NP_001285988.1 Gene:ppk17 / 35006 FlyBaseID:FBgn0032602 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_741622.2 Gene:del-6 / 179474 WormBaseID:WBGene00011891 Length:577 Species:Caenorhabditis elegans


Alignment Length:537 Identity:105/537 - (19%)
Similarity:191/537 - (35%) Gaps:156/537 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WSETRAWLFRDPAKLIRYLVLFACCIVVIVQ-LYECFAKLYNPPISTHSYYSLNETIEMPSVTIC 67
            |.:.   ||...|:...::.:.|...|:.|: :::.|.:.::.|..:......||::.||:||.|
 Worm    31 WKDA---LFGRRARKYAFVFIVAFLAVLTVKDVFDLFEEYFDYPKESDINIVFNESMTMPNVTFC 92

  Fly    68 --REPPYK-------------EEVLTRLSGGACPHPKYATCWMKYPFG----------------- 100
              |:..:.             :.|:.........|..:    ||.|:.                 
 Worm    93 MSRQQAWSHFKLNLTAPADEWDAVVDENLANMTDHDAF----MKTPWDYRLVMEAYDMIATYSSL 153

  Fly   101 ---------------------------------------EISLDEF---------------FENS 111
                                                   .|:.|||               |...
 Worm   154 ERETTAHGSARSIHVFKNAPRLAAKRKTFKKWRDILDSRGITFDEFTQKTGIEVLRRSMQRFRRR 218

  Fly   112 THDSGDTFVFYGLNEDKNNVVMNSSLHFYMGRCYTLRP---KESAKRV-SKAVGYSIMLEHSMLT 172
            |.|..:|.:     :.|..:...|.:..    |:  :|   :::.|.: .:.|.:.::|.|:...
 Worm   219 TFDDDETVI-----KTKLRISWISQMQI----CF--QPEFDQDNFKTIDDQGVFFDMLLSHNAEN 272

  Fly   173 TSVSDVDTGSVGWHVFIHDKKENFTEINMKGSGR-----VEYVFVGVNEEIEIKLQTQYFSNVQT 232
            |....:|..||.:    |.:..:.... |:|.||     |:.|.:|...|:...: |..:..::.
 Worm   273 TEGQKIDCMSVDF----HGRPSSLNRF-MEGKGRSRDGYVDEVCLGQRHEVTAHV-TALYQMLEN 331

  Fly   233 REEA--CSD--DENYSDLKCGEQCIWQDLADNMQCSGPWMHEIASEPCNDSLSMRK------LIS 287
            .|:.  |.|  |...|:..|..:|..:.:.|...|:          |.:.|...:|      .:.
 Worm   332 DEQGTRCRDVEDGEDSEFNCRSRCRMEMIRDACHCT----------PLSLSYLAKKEDMEIFPLC 386

  Fly   288 DYK----DVYE-NEDDFDC--DCVQPCQSRIYTTFIQNRKAFNQPEPRTQIYIYYTTKLISMIEE 345
            ||.    ||.: |..|.:|  .|...|:...:......:....:|: .|.:.:.:.......:|:
 Worm   387 DYTQCTVDVQKGNYSDTECANKCFPDCRQIRFEVDHSVKGRMLRPD-LTLVELSWGPFEYLTMEQ 450

  Fly   346 RPSYDTTQFIADVGGSLGFLLGLSVLGLIGILEHMMLFFCGGFI-KRMQQKEQA--KLEANSEDG 407
            :..|..|.|||.:|||:|..||||:|.||.::.:...:|....: :|:.:|...  |.:...|||
 Worm   451 QWKYSATSFIAALGGSIGMWLGLSILSLIQLVTYSYTYFTKKIVNERILKKGNTFDKKDEGDEDG 515

  Fly   408 QSQTSDETIDVEIAYKK 424
                 |.|||.....||
 Worm   516 -----DFTIDNGTERKK 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk17NP_001285988.1 ASC 11..358 CDD:295594 80/459 (17%)
del-6NP_741622.2 ASC <347..484 CDD:295594 36/147 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163593
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.