DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk17 and LOC1281572

DIOPT Version :10

Sequence 1:NP_609809.1 Gene:ppk17 / 35006 FlyBaseID:FBgn0032602 Length:431 Species:Drosophila melanogaster
Sequence 2:XP_061499536.1 Gene:LOC1281572 / 1281572 VectorBaseID:AGAMI1_009034 Length:653 Species:Anopheles gambiae


Alignment Length:33 Identity:10/33 - (30%)
Similarity:14/33 - (42%) Gaps:5/33 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 YKAICRT--CKICGKGFVH---HKTYRYHMLTH 43
            :.||.|.  |.||.:...|   .:.|....|:|
Mosquito   130 HMAIRRNHRCPICRRRARHFHVRRIYSPSFLSH 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk17NP_609809.1 ASC 22..358 CDD:459966 7/27 (26%)
LOC1281572XP_061499536.1 None

Return to query results.
Submit another query.