DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk17 and Asic2

DIOPT Version :9

Sequence 1:NP_001285988.1 Gene:ppk17 / 35006 FlyBaseID:FBgn0032602 Length:431 Species:Drosophila melanogaster
Sequence 2:XP_006532059.1 Gene:Asic2 / 11418 MGIID:1100867 Length:596 Species:Mus musculus


Alignment Length:346 Identity:64/346 - (18%)
Similarity:119/346 - (34%) Gaps:103/346 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 GRCYTLRPKESAKRVSKAV------GYSIML----EHSMLTTSVSDVDTGSVGWHVFIHDKKENF 196
            |:||.....|..|.:...|      |..|||    :..:.....::..|...|..|.||.:.|. 
Mouse   275 GKCYMFNSGEDGKPLLTTVKGGTGNGLEIMLDIQQDEYLPIWGETEETTFEAGVKVQIHSQSEP- 338

  Fly   197 TEINMKGSGRVEYVFVGVNEEIEIKLQTQYFSNVQTREE----------ACSDDEN-------YS 244
                         .|:   :|:...:...:.:.|.|:|:          .|...|.       ||
Mouse   339 -------------PFI---QELGFGVAPGFQTFVATQEQRLTYLPPPWGECRSSEMGLDFFPVYS 387

  Fly   245 DLKCGEQCIWQDLADNMQC-----------SGPWMHEIASEPCNDSLSMRKLISDYKDVYENEDD 298
            ...|...|..:.:.:|..|           ..|..|:..:||....|:            |.:.:
Mouse   388 ITACRIDCETRYIVENCNCRMVHMPGDAPFCTPEQHKECAEPALGLLA------------EKDSN 440

  Fly   299 FDCDCVQPCQSRIY------------TTFIQNRKAFNQPEPRTQ-----IYIYYTTKLISMIEER 346
            : |.|..||....|            |:.....|.||:.|....     :.|::.......||::
Mouse   441 Y-CLCRTPCNLTRYNKELSMVKIPSKTSAKYLEKKFNKSEKYISENILVLDIFFEALNYETIEQK 504

  Fly   347 PSYDTTQFIADVGGSLGFLLGLSVLGLIGILEHM-------MLFFCGGFIKRMQQKEQAKLEAN- 403
            .:|:....:.|:||.:|..:|.|:|.::.:.:::       :|...|      :::|:...:.| 
Mouse   505 KAYEVAALLGDIGGQMGLFIGASILTILELFDYIYELIKEKLLDLLG------KEEEEGSHDENM 563

  Fly   404 ----SEDGQSQTSDETIDVEI 420
                :....|:|...|::|.:
Mouse   564 STCDTMPNHSETISHTVNVPL 584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk17NP_001285988.1 ASC 11..358 CDD:295594 49/270 (18%)
Asic2XP_006532059.1 ASC 64..590 CDD:383197 64/346 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842225
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.