DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-b and YBR053C

DIOPT Version :9

Sequence 1:NP_001285987.1 Gene:yellow-b / 35005 FlyBaseID:FBgn0032601 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_009609.1 Gene:YBR053C / 852342 SGDID:S000000257 Length:358 Species:Saccharomyces cerevisiae


Alignment Length:166 Identity:34/166 - (20%)
Similarity:66/166 - (39%) Gaps:35/166 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 AYEWREMDFKYANPDQRWSAIERGEFKPANVIPFG----LEVAGHRL-----FVTLP---RWRDG 77
            ||:.|..|.. .:||.::..:......|.::.|.|    :::..|::     .:.:|   .|.:.
Yeast   144 AYKLRSNDGN-VSPDGKYIYVGLMSDFPFDLEPIGCLLRVDLLAHKIELVWNCLLIPNAIHWDES 207

  Fly    78 VPASLAYLD-LNDTSSKGPA--------LKPFPSWQAHNLQEAEPELVSPFRVRADRCGRLWV-L 132
            ...::...| ||.|..|.|.        |....:....:.:..||:           ...:|. .
Yeast   208 DQKTMYVTDSLNFTIWKCPGGDLLKRDELIDVKNSNNQSFESPEPD-----------GSAIWFSK 261

  Fly   133 DSRISGVLEQTKIYGAAQLLVYDLHNDDLLRRHVLP 168
            |.:.||.|..| ::..:::.::||.|..||:..:||
Yeast   262 DGKHSGFLFIT-VWSTSKVQMFDLTNGKLLKEFILP 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-bNP_001285987.1 MRJP 116..402 CDD:281074 13/54 (24%)
YBR053CNP_009609.1 YvrE 1..345 CDD:225921 34/166 (20%)
WD40 repeat 150..186 CDD:293791 6/36 (17%)
WD40 repeat 199..248 CDD:293791 9/48 (19%)
WD40 repeat 259..294 CDD:293791 10/35 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.