DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-b and yellow-h

DIOPT Version :9

Sequence 1:NP_001285987.1 Gene:yellow-b / 35005 FlyBaseID:FBgn0032601 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_651912.3 Gene:yellow-h / 43779 FlyBaseID:FBgn0039896 Length:463 Species:Drosophila melanogaster


Alignment Length:416 Identity:152/416 - (36%)
Similarity:246/416 - (59%) Gaps:24/416 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ANDNLRVAYEWREMDFKYANPDQRWSAIERGEFKPANVIPFGLEVAGHRLFVTLPRWRDGVPASL 82
            :...|.:.|||:.:||.|:...||..:|..|:|.|.|.:|.|::|..:|||||.|||::||||||
  Fly    49 SESQLEIVYEWKYLDFLYSTFVQRQQSILNGDFVPKNNLPLGIDVHNNRLFVTTPRWKNGVPASL 113

  Fly    83 AYLDLNDTSSKGPALKPFPSWQAHNLQEAEPE---LVSPFRVRADRCGRLWVLDSRISGVLEQTK 144
            ..|......| .||:||:|:|:||. ....|:   |:|.:|...|||.|:|::||.|........
  Fly   114 GTLPFPPKES-SPAIKPYPNWEAHG-NPNNPDCSKLMSVYRTAVDRCDRIWLIDSGIVNATINLN 176

  Fly   145 IYGAAQLLVYDLHNDDLLRRHVLPAGQLKQGSLLANLAVE-DSDCENTFAYAADLGSPGLVVYSW 208
            .....:::||||.:|:|:.|:.|.|..:||.||.:|:.|: ..||::..|..:|:...||:|||.
  Fly   177 QICPPKIVVYDLKSDELIVRYNLEASHVKQDSLHSNIVVDIGEDCDDAHAIVSDVWRFGLLVYSL 241

  Fly   209 KDEESWRVQHHFFHPDPMAGNFSINGIEFQWDDGLYGLALSKPLETGYATLYFHPLCSTTEFSVD 273
            ....||||.::.|:|||.|.:|::.|:.|||.||::|:::....:.....|||||:.|..||.|.
  Fly   242 SKNRSWRVTNYNFYPDPFASDFNVYGLNFQWLDGVFGMSIYYNKKIMERVLYFHPMASFKEFMVP 306

  Fly   274 TSILRNKTL-ATSPMIYREFKV-LGSRGPNTQAGAEFLDPDTGVLFYALPNLNEVACWRTATDFS 336
            .:||.|::: .|:...|.::.: :|.||.|:|:....:..: |::|:...:.:::.||.|:..::
  Fly   307 MNILLNESVWQTNTQEYAKYFIPIGDRGYNSQSSTSGVTRN-GIMFFTQVHQDDIGCWDTSKPYT 370

  Fly   337 HSSQSRIH-MNNDTLV-FPSDIKVDDQK--RLWVLSNQLPVFIYDELYAGSINFRILTASVKEAI 397
            .:...:.| |.|..|: ||:|:|||.:|  .:|::||:||:|:|..|..|.:|||||.|:|.:.|
  Fly   371 RAHLGKFHNMENSNLIQFPNDLKVDKEKDQNVWLISNRLPIFLYSNLDYGEVNFRILKANVNKII 435

  Fly   398 ENTACEIRTSPLPDVINKLGDILNTN 423
            .|:.|.      ||     ...:||:
  Fly   436 RNSVCN------PD-----NSYINTS 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-bNP_001285987.1 MRJP 116..402 CDD:281074 104/292 (36%)
yellow-hNP_651912.3 MRJP 148..440 CDD:281074 104/292 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449203
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D23419at7147
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.