DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-b and yellow-e2

DIOPT Version :9

Sequence 1:NP_001285987.1 Gene:yellow-b / 35005 FlyBaseID:FBgn0032601 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_650289.2 Gene:yellow-e2 / 41652 FlyBaseID:FBgn0038151 Length:435 Species:Drosophila melanogaster


Alignment Length:409 Identity:123/409 - (30%)
Similarity:200/409 - (48%) Gaps:47/409 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VAYEWREMDFKYANPDQRWSAIERGEFKPANVIPFGLEV------AGHRLFVTLPRWRDGVPASL 82
            :.:||:.:.:.:.:..:|...:..|.:.|.:.||..::|      ...|.|||.||:..|||.||
  Fly    43 IVFEWKNLQYGFPSEQERDQVLRNGRYNPDSPIPIDIDVYYPPNGGPPRHFVTSPRFGQGVPFSL 107

  Fly    83 AYLDLNDTSSKGPALKPFPSWQAHNLQEAEPE-LVSPFRVRADRCGRLWVLDSRISGVLEQTKIY 146
            .|: .|.....|..::.:||:|.|:...|..: |.|.:||..|.||::||||   ||.:|..: :
  Fly   108 GYV-TNVQRENGSEIQAYPSYQWHSSHGANCDGLTSVYRVHIDACGQMWVLD---SGEIEFVQ-H 167

  Fly   147 GAAQLLVYDLHNDDLLRRHVLPAGQLK-QGSLLANLAVEDSD------CENTFAYAADLGSPGLV 204
            .|.|::|:||..|.|:.|:.||....| :.|...|:..:..|      |::.|||.||..|..:|
  Fly   168 CAPQVMVFDLATDQLIHRYRLPETSYKAKVSRFVNIFADIRDPPPSGQCKDVFAYLADPTSKAIV 232

  Fly   205 VYSWKDEESWRVQHHFFHPDPMAGNFSINGIEFQWDDGLYGLALSKPLETGYAT-LYFHPLCSTT 268
            ||....:.|||:::.|.:||...|..::.|..|:..||...|| :.||..|... |.||.|.:..
  Fly   233 VYDVVGQSSWRIENKFTYPDAKFGTHTVAGESFELLDGPLALA-TTPLGLGLRRHLIFHALSNEL 296

  Fly   269 EFSVDTSILRNKT-----LATSPMIYREFKVLGSRGPNTQAGAEFLDPDTGVLFYALPNLNEVAC 328
            |.::...||.|.|     |::|   ..||.|||.||  .|..:..:... |.||........:..
  Fly   297 ELAIPLDILNNATNWQKGLSSS---LSEFTVLGKRG--IQCASHAISRQ-GFLFCGFLEPIGIFG 355

  Fly   329 WRTATDFSHSSQSRIHMNNDTLVFPSDIKV-----DDQKRLWVLSNQLPVFIYDELYAGS----- 383
            |.....::..:...:.:|..||.|.|.:|:     |.::.||:||::|     .:::||:     
  Fly   356 WDIRRPYNRENVKLLAINPATLQFVSGMKIVRRPADGREELWLLSDRL-----QKIFAGTIDYRE 415

  Fly   384 INFRILTASVKEAIENTAC 402
            ||:|::...|.:.::...|
  Fly   416 INYRVMRCDVDDLLQGRGC 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-bNP_001285987.1 MRJP 116..402 CDD:281074 94/308 (31%)
yellow-e2NP_650289.2 MRJP 141..434 CDD:281074 94/308 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449212
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D940689at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.